").append(n.parseHTML(a)).find(d):a)}).complete(c&&function(a,b){g.each(c,e||[a.responseText,b,a])}),this},n.expr.filters.animated=function(a){return n.grep(n.timers,function(b){return a===b.elem}).length};var dd=a.document.documentElement;function ed(a){return n.isWindow(a)?a:9===a.nodeType?a.defaultView||a.parentWindow:!1}n.offset={setOffset:function(a,b,c){var d,e,f,g,h,i,j,k=n.css(a,"position"),l=n(a),m={};"static"===k&&(a.style.position="relative"),h=l.offset(),f=n.css(a,"top"),i=n.css(a,"left"),j=("absolute"===k||"fixed"===k)&&n.inArray("auto",[f,i])>-1,j?(d=l.position(),g=d.top,e=d.left):(g=parseFloat(f)||0,e=parseFloat(i)||0),n.isFunction(b)&&(b=b.call(a,c,h)),null!=b.top&&(m.top=b.top-h.top+g),null!=b.left&&(m.left=b.left-h.left+e),"using"in b?b.using.call(a,m):l.css(m)}},n.fn.extend({offset:function(a){if(arguments.length)return void 0===a?this:this.each(function(b){n.offset.setOffset(this,a,b)});var b,c,d={top:0,left:0},e=this[0],f=e&&e.ownerDocument;if(f)return b=f.documentElement,n.contains(b,e)?(typeof e.getBoundingClientRect!==L&&(d=e.getBoundingClientRect()),c=ed(f),{top:d.top+(c.pageYOffset||b.scrollTop)-(b.clientTop||0),left:d.left+(c.pageXOffset||b.scrollLeft)-(b.clientLeft||0)}):d},position:function(){if(this[0]){var a,b,c={top:0,left:0},d=this[0];return"fixed"===n.css(d,"position")?b=d.getBoundingClientRect():(a=this.offsetParent(),b=this.offset(),n.nodeName(a[0],"html")||(c=a.offset()),c.top+=n.css(a[0],"borderTopWidth",!0),c.left+=n.css(a[0],"borderLeftWidth",!0)),{top:b.top-c.top-n.css(d,"marginTop",!0),left:b.left-c.left-n.css(d,"marginLeft",!0)}}},offsetParent:function(){return this.map(function(){var a=this.offsetParent||dd;while(a&&!n.nodeName(a,"html")&&"static"===n.css(a,"position"))a=a.offsetParent;return a||dd})}}),n.each({scrollLeft:"pageXOffset",scrollTop:"pageYOffset"},function(a,b){var c=/Y/.test(b);n.fn[a]=function(d){return W(this,function(a,d,e){var f=ed(a);return void 0===e?f?b in f?f[b]:f.document.documentElement[d]:a[d]:void(f?f.scrollTo(c?n(f).scrollLeft():e,c?e:n(f).scrollTop()):a[d]=e)},a,d,arguments.length,null)}}),n.each(["top","left"],function(a,b){n.cssHooks[b]=Mb(l.pixelPosition,function(a,c){return c?(c=Kb(a,b),Ib.test(c)?n(a).position()[b]+"px":c):void 0})}),n.each({Height:"height",Width:"width"},function(a,b){n.each({padding:"inner"+a,content:b,"":"outer"+a},function(c,d){n.fn[d]=function(d,e){var f=arguments.length&&(c||"boolean"!=typeof d),g=c||(d===!0||e===!0?"margin":"border");return W(this,function(b,c,d){var e;return n.isWindow(b)?b.document.documentElement["client"+a]:9===b.nodeType?(e=b.documentElement,Math.max(b.body["scroll"+a],e["scroll"+a],b.body["offset"+a],e["offset"+a],e["client"+a])):void 0===d?n.css(b,c,g):n.style(b,c,d,g)},b,f?d:void 0,f,null)}})}),n.fn.size=function(){return this.length},n.fn.andSelf=n.fn.addBack,"function"==typeof define&&define.amd&&define("jquery",[],function(){return n});var fd=a.jQuery,gd=a.$;return n.noConflict=function(b){return a.$===n&&(a.$=gd),b&&a.jQuery===n&&(a.jQuery=fd),n},typeof b===L&&(a.jQuery=a.$=n),n});
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/search.html b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/search.html
deleted file mode 100644
index ad452b622..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/search.html
+++ /dev/null
@@ -1,35 +0,0 @@
-
-
-
-
System.Linq.Dynamic.Core, EntityFramework.DynamicLinq and Microsoft.EntityFrameworkCore.DynamicLinq - Search
-
-
-
-
-
-
-
-
-
-
-
-
-
-
- Sort by title
-
-
-
-
-
- Back
-
-
-
-
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-Help1.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-Help1.css
deleted file mode 100644
index 8f7ba25a3..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-Help1.css
+++ /dev/null
@@ -1,40 +0,0 @@
-/* Define the userData cache persistence mechanism for Help 1 files */
-.userDataStyle {
- behavior: url(#default#userdata);
-}
-
-/* Style adjustments for Help 1 */
-.pageBody {
- padding-top: 0px 20px 0px 0px;
-}
-
-table {
- width: 95%;
- padding-right: 20px;
-}
-
-table.members {
- width: 95%;
- padding-right: 20px;
-}
-
-th p {
- padding-bottom: 0px;
-}
-
-td p {
- padding-bottom: 5px;
-}
-
-.codeSnippetContainerTabs {
- top: 1px;
-}
-
-.codeSnippetToolBarText {
- top: -13px;
-}
-
-.codeSnippetContainerTabSingle {
- padding: 2px 15px 0px 15px;
- height: 22px;
-}
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-HelpViewer.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-HelpViewer.css
deleted file mode 100644
index 951621be6..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-HelpViewer.css
+++ /dev/null
@@ -1,48 +0,0 @@
-/* Style adjustments for Help Viewer */
-.pageBody {
- padding-top: 0px 20px 0px 0px;
-}
-
-table {
- width: 95%;
- padding-right: 20px;
-}
-
-table.members {
- width: 95%;
- padding-right: 20px;
-}
-
-th p {
- padding-bottom: 0px;
-}
-
-td p {
- padding-bottom: 5px;
-}
-
-.codeSnippetContainerTabs {
- top: 1px;
-}
-
-.codeSnippetToolBarText {
- top: -13px;
-}
-
-.codeSnippetContainerTabSingle {
- padding: 2px 15px 0px 15px;
- height: 22px;
-}
-
-.codeSnippetContainerTab a:visited {
- color: #000000;
-}
-
-.codeSnippetContainerTabActive a:visited {
- color: #000000;
-}
-
-span.keyword {
- color: #0000ff;
- font-weight: normal;
-}
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-Website.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-Website.css
deleted file mode 100644
index d39e08c77..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-Website.css
+++ /dev/null
@@ -1,156 +0,0 @@
-/* Style adjustments for websites */
-.pageBody {
- padding: 0px 20px 0px 0px;
-}
-.topicContent {
- margin-left: 280px;
-}
-
-/* Lightweight TOC */
-.tocCollapsed {
- background: url('../icons/TocCollapsed.gif') no-repeat scroll center;
- width: 17px;
- height: 20px;
- overflow: hidden;
-}
-.tocExpanded {
- background: url('../icons/TocExpanded.gif') no-repeat scroll center;
- width: 17px;
- height: 20px;
- overflow: hidden;
-}
-.tocResize {
- position: absolute;
- top: 90px;
- left: 300px;
- width: 5px;
- height: 20px;
- padding-right: 5px;
-}
-.tocResize img {
- border: none;
- cursor: pointer;
-}
-div#leftNav {
- float: left;
- margin: 0px -1px 0 0;
- width: 280px;
- min-height: 10px;
- position: relative;
- border-right: 1px solid #b6b6b6;
- padding-left: 10px;
- padding-top: 15px;
-}
-div#tocNav {
- font-family: 'Segoe UI' ,Verdana,Arial;
- overflow-x: hidden;
- line-height: normal;
- margin: -20px 0 0 -4px;
-}
-div#tocNav > div {
- overflow-x: hidden;
- white-space: normal;
- width: auto;
- margin-bottom: 5px;
-}
-div#leftNav a, div#leftNav a:link, div#leftNav a:visited {
- color: #1364c4;
- text-decoration: none;
-}
-div#leftNav a:hover {
- color: #3390b1;
-}
-div#tocNav > div > a, div#tocNav > div > a:link, div#tocNav > div > a:visited {
- display: block;
- margin-left: 18px;
- overflow: hidden;
-}
-div#tocNav > div.current > a, div#tocNav > div.current > a:link, div#tocNav > div.current > a:visited {
- color: #000;
- font-weight: bold;
- text-decoration: none;
-}
-div#tocNav > div > a.tocExpanded, div#tocNav > div > a.tocCollapsed {
- float: left;
- display: inline-block;
- margin-left: 0;
- vertical-align: top;
-}
-div#tocResizableEW {
- cursor: e-resize;
- width: 15px;
- top: 0;
- height: 100%;
- position: absolute;
- display: block;
- font-size: 0.5px;
- right: -7px;
-}
-.toclevel0:first-child {
- margin-top: 16px;
-}
-div#tocNav > div.toclevel1 {
- padding-left: 17px;
-}
-div#tocNav > div.toclevel2 {
- padding-left: 34px;
-}
-div#tocNav > div.toclevel3 {
- padding-left: 51px;
-}
-div#tocNav > div.toclevel4 {
- padding-left: 68px;
-}
-div#tocNav > div.toclevel5 {
- padding-left: 85px;
-}
-div#tocNav > div.toclevel6 {
- padding-left: 102px;
-}
-div#tocNav > div.toclevel7 {
- padding-left: 119px;
-}
-div#tocNav > div.toclevel8 {
- padding-left: 136px;
-}
-div#tocNav > div.toclevel9 {
- padding-left: 153px;
-}
-div#tocNav > div.toclevel10 {
- padding-left: 170px;
-}
-
-/* Search form */
-form#SearchForm {
- float: right;
- background-color: #eee;
- width: 280px;
-}
-form#SearchForm input {
- background-color: #eee;
- border: 0;
- height: 22px;
- width: 230px;
- color: #3b3b3b;
- display: inline-block;
- margin: 1px 0 0 0;
- padding: 1px 4px 1px 10px;
-}
-form#SearchForm button {
- background: url('../icons/Search.png') no-repeat scroll center;
- background-color: #eee;
- float: right;
- border: 0;
- margin: 3px 2px 0 0;
- cursor: pointer;
- color: #3b3b3b;
- width: 19px;
- height: 18px;
- overflow: hidden;
-}
-.searchContainer {
- width: 700px;
- margin-top: 50px;
- margin-left: auto;
- margin-right: auto;
-}
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-cs-CZ.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-cs-CZ.css
deleted file mode 100644
index f38de7497..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-cs-CZ.css
+++ /dev/null
@@ -1,3 +0,0 @@
-/* Start CS-CZ locale-specific CSS */
-
-/* End locale-specific CSS */
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-de-DE.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-de-DE.css
deleted file mode 100644
index 4cf80badd..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-de-DE.css
+++ /dev/null
@@ -1,3 +0,0 @@
-/* Start DE-DE locale-specific CSS */
-
-/* End locale-specific CSS */
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-en-US.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-en-US.css
deleted file mode 100644
index 248cbe5a2..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-en-US.css
+++ /dev/null
@@ -1,3 +0,0 @@
-/* Start EN-US locale-specific CSS */
-
-/* End locale-specific CSS */
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-es-ES.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-es-ES.css
deleted file mode 100644
index 4a7ebbd68..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-es-ES.css
+++ /dev/null
@@ -1,3 +0,0 @@
-/* Start ES-ES locale-specific CSS */
-
-/* End locale-specific CSS */
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-fr-FR.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-fr-FR.css
deleted file mode 100644
index d924dec96..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-fr-FR.css
+++ /dev/null
@@ -1,3 +0,0 @@
-/* Start FR-FR locale-specific CSS */
-
-/* End locale-specific CSS */
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-it-IT.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-it-IT.css
deleted file mode 100644
index 36c6b224f..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-it-IT.css
+++ /dev/null
@@ -1,3 +0,0 @@
-/* Start IT-IT locale-specific CSS */
-
-/* End locale-specific CSS */
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-ja-JP.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-ja-JP.css
deleted file mode 100644
index 403aa6ddf..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-ja-JP.css
+++ /dev/null
@@ -1,18 +0,0 @@
-/* Start JA-JP locale-specific CSS */
-body
-{
- font-family: Segoe UI, Verdana, Arial, MS Pゴシック;
-}
-pre
-{
- font-family: Consolas, Courier, monospace, MS ゴシック;
-}
-span.tt
-{
- font-family: Consolas, Courier, monospace, MS ゴシック;
-}
-span.code
-{
- font-family: Consolas, Courier, monospace, MS ゴシック;
-}
-/* End locale-specific CSS */
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-ko-KR.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-ko-KR.css
deleted file mode 100644
index 2b46e923e..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-ko-KR.css
+++ /dev/null
@@ -1,19 +0,0 @@
-/* Start KO-KR locale-specific CSS */
-body
-{
- font-family: Malgun Gothic, Segoe UI, Verdana, Arial;
- font-size: 0.75em; /*9pt*/
-}
-pre
-{
- font-family: Consolas, Courier, monospace, 돋움체;
-}
-span.tt
-{
- font-family: Consolas, Courier, monospace, 돋움체;
-}
-span.code
-{
- font-family: Consolas, Courier, monospace, 돋움체;
-}
-/* End locale-specific CSS */
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-pl-PL.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-pl-PL.css
deleted file mode 100644
index 19e981032..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-pl-PL.css
+++ /dev/null
@@ -1,3 +0,0 @@
-/* Start PL-PL locale-specific CSS */
-
-/* End locale-specific CSS */
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-pt-BR.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-pt-BR.css
deleted file mode 100644
index a0683b0ef..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-pt-BR.css
+++ /dev/null
@@ -1,3 +0,0 @@
-/* Start PT-BR locale-specific CSS */
-
-/* End locale-specific CSS */
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-ru-RU.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-ru-RU.css
deleted file mode 100644
index c31f83a44..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-ru-RU.css
+++ /dev/null
@@ -1,3 +0,0 @@
-/* Start RU-RU locale-specific CSS */
-
-/* End locale-specific CSS */
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-tr-TR.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-tr-TR.css
deleted file mode 100644
index 81ca462ef..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-tr-TR.css
+++ /dev/null
@@ -1,3 +0,0 @@
-/* Start TR-TR locale-specific CSS */
-
-/* End locale-specific CSS */
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-zh-CN.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-zh-CN.css
deleted file mode 100644
index 87e7090d7..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-zh-CN.css
+++ /dev/null
@@ -1,18 +0,0 @@
-/* Start ZH-CN locale-specific CSS */
-body
-{
- font-family: "Microsoft YaHei UI","Microsoft YaHei","SimSun","Segoe UI","Lucida Grande",Verdana,Arial,Helvetica,sans-serif
-}
-pre
-{
- font-family: Consolas, Courier, monospace!important;
-}
-span.tt
-{
- font-family: Consolas, Courier, monospace;
-}
-span.code
-{
- font-family: Consolas, Courier, monospace;
-}
-/* End locale-specific CSS */
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-zh-TW.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-zh-TW.css
deleted file mode 100644
index eab654f8c..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding-zh-TW.css
+++ /dev/null
@@ -1,18 +0,0 @@
-/* Start ZH-TW locale-specific CSS */
-body
-{
- font-family: MS JhengHei, MingLiU, Segoe UI, Verdana, Arial;
-}
-pre
-{
- font-family: Consolas, Courier, monospace, 細明體;
-}
-span.tt
-{
- font-family: Consolas, Courier, monospace, 細明體;
-}
-span.code
-{
- font-family: Consolas, Courier, monospace, 細明體;
-}
-/* End locale-specific CSS */
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding.css
deleted file mode 100644
index 685032039..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/branding.css
+++ /dev/null
@@ -1,583 +0,0 @@
-/* General styles */
-body {
- font-family: 'Segoe UI' , 'Lucida Grande' , Verdana, Arial, Helvetica, sans-serif;
- font-size: 15px;
- padding: 0;
- margin: 0;
- margin-left: auto;
- margin-right: auto;
- color: #000;
-}
-h1 {
- font-family: 'Segoe UI' , 'Lucida Grande' , Verdana, Arial, Helvetica, sans-serif;
- font-size: 2.5em;
- font-weight: normal;
- margin-top: 0;
- color: #000;
-}
-h2, h3 {
- font-family: 'Segoe UI Semibold' , 'Segoe UI' , 'Lucida Grande' , Verdana, Arial, Helvetica, sans-serif;
- font-weight: normal;
- margin: 0;
- padding-bottom: 5px;
- padding-top: 5px;
- color: #000;
-}
-h2 {
- font-size: 1.769em;
-}
-h3 {
- font-size: 1.231em;
-}
-h4, .subHeading {
- font-family: 'Segoe UI Semibold' , 'Segoe UI' , 'Lucida Grande' , Verdana, Arial, Helvetica, sans-serif;
- font-size: 1.077em;
- font-weight: normal;
- margin: 0;
- color: #000;
-}
-.subHeading {
- margin-top: 5px;
-}
-h5, h6 {
- font-family: 'Segoe UI Semibold' , 'Segoe UI' , 'Lucida Grande' , Verdana, Arial, Helvetica, sans-serif;
- font-size: 1em;
- font-weight: normal;
- line-height: 130%;
- margin: 0;
- color: #000;
-}
-a, a:link {
- text-decoration: none;
- color: #1364c4;
-}
-a:visited, a:active {
- text-decoration: none;
- color: #03697a;
-}
-a:hover {
- text-decoration: none;
- color: #3390b1;
-}
-a.button, a.button:active, a.button:hover {
- float: right;
- background-color: #0080c0;
- color: white;
- padding: 6px 12px;
- font-size: 14px;
- border: 1px solid transparent;
- border-radius: 4px;
- margin-left: 6px;
-}
-a.button:link, a.button:visited {
- color: white;
-}
-img {
- border: 0;
-}
-p {
- margin-top: 0;
- margin-bottom: 0;
- padding-bottom: 15px;
- line-height: 18px;
-}
-q {
- font-style: italic;
-}
-blockquote {
- margin-top: 0px;
-}
-table {
- border-collapse: collapse;
- padding: 0;
- margin-bottom: 15px;
- font-size: 15px;
- width: 100%;
-}
-td, th {
- border-bottom: 1px solid #dbdbdb;
- margin: 10px;
- padding-top: 10px;
- padding-bottom: 10px;
- padding-right: 8px;
- padding-left: 8px;
-}
-th {
- background-color: #ededed;
- color: #636363;
- text-align: left;
- padding-top: 5px;
- padding-bottom: 5px;
-}
-td {
- color: #2a2a2a;
- vertical-align: top;
-}
-table p:last-child {
- padding-bottom: 0;
-}
-table.members {
- width: 100%;
-}
-table.members td {
- min-width: 72px;
-}
-table.members img {
- padding-right: 5px;
-}
-div.alert img {
- padding-right: 5px;
-}
-ol {
- margin-top: 0px;
- margin-bottom: 10px;
-}
-ol ol {
- list-style-type: lower-alpha;
-}
-ol ol ol {
- list-style-type: lower-roman;
-}
-ul {
- margin-top: 0px;
- margin-bottom: 10px;
-}
-.noBullet {
- list-style-type: none;
- padding-left: 20px;
-}
-ul ul {
- list-style-type: circle;
-}
-ul ul ul {
- list-style-type: square;
-}
-dt {
- font-weight: 600;
-}
-pre {
- font-family: Consolas, Courier, monospace;
- overflow: hidden;
-}
-.pageHeader {
- font-family: 'Segoe UI' , Tahoma, Helvetica, Sans-Serif;
- background-color: #333333;
- color: #d0d0d0;
- padding: 5px 10px;
- vertical-align: middle;
- height: 25px;
-}
-.pageBody {
- padding: 0px;
-}
-.topicContent {
- padding: 10px 10px 15px 10px;
- overflow: visible;
- border-left: 1px solid #bbb;
-}
-.pageFooter {
- clear: both;
- border-top: solid 1px #bbb;
- padding: 10px;
-}
-.feedbackLink {
-}
-.iconColumn {
- width: 100px;
-}
-.seeAlsoStyle {
-}
-table.titleTable td {
- padding-top: 0px;
- border-width: 0px;
-}
-td.titleColumn {
- margin-top: 0px;
- padding-left: 0px;
- vertical-align: middle;
-}
-td.logoColumn {
- padding-left: 0px;
- padding-right: 10px;
- vertical-align: middle;
- width: 1px;
-}
-td.logoColumnAbove {
- padding: 0px 10px 0px 0px;
- vertical-align: middle;
-}
-span.selflink {
- color: #000066;
-}
-div.preliminary {
- margin-top: 1em;
- margin-bottom: 1em;
- font-weight: bold;
- color: #333333;
-}
-div.caption {
- font-weight: bold;
- font-size: 1em; /*12pt*/
- color: #003399;
- padding-top: 5px;
- padding-bottom: 5px;
-}
-.procedureSubHeading {
- font-size: 1.1em; /*13.5pt*/
- font-weight: bold;
-}
-.summary {
-}
-
-/* Collapsible region styles */
-.collapsibleAreaRegion {
- margin-top: 15px;
- margin-bottom: 15px;
-}
-.collapseToggle {
- padding-right: 5px;
-}
-.collapsibleRegionTitle {
- font-family: 'Segoe UI Semibold' , 'Segoe UI' , 'Lucida Grande' , Verdana, Arial, Helvetica, sans-serif !important;
- font-style: normal !important;
- font-size: 1.769em;
- margin-top: 9px;
- margin-bottom: 19px;
- padding-top: 20px;
- padding-bottom: 5px;
- cursor: pointer;
-}
-.collapsibleSection {
- padding: 0 0 0 20px;
-}
-
-/* Syntax and code snippet styles */
-.codeSnippetContainer {
- min-width: 260px;
- margin-top: 10px;
-}
-.codeSnippetContainerTabs {
- height: 23px;
- vertical-align: middle;
- position: relative;
- z-index: 1;
-}
-.codeSnippetContainerTab {
- padding: 0px 15px;
- width: auto;
- height: 22px;
- color: #2a2a2a;
- font-family: "Segoe UI" , "Lucida Grande" , Verdana, Arial, Helvetica, sans-serif !important;
- font-size: 12px;
- font-style: normal !important;
- vertical-align: baseline;
- float: left;
-}
-.codeSnippetContainerTabActive {
- background: #f8f8f8;
- padding: 0px 15px;
- width: auto;
- height: 22px;
- color: #000000;
- font-family: "Segoe UI" , "Lucida Grande" , Verdana, Arial, Helvetica, sans-serif !important;
- font-size: 12px;
- font-style: normal !important;
- vertical-align: baseline;
- border-top-color: #939393;
- border-right-color: #939393;
- border-left-color: #939393;
- border-top-width: 1px;
- border-right-width: 1px;
- border-left-width: 1px;
- border-top-style: solid;
- border-right-style: solid;
- border-left-style: solid;
- float: left;
-}
-.codeSnippetContainerTabPhantom {
- background: #f8f8f8;
- padding: 0px 15px;
- width: auto;
- height: 22px;
- color: #000000;
- font-family: "Segoe UI" , "Lucida Grande" , Verdana, Arial, Helvetica, sans-serif !important;
- font-size: 12px;
- font-style: normal !important;
- vertical-align: baseline;
- border-top-color: #939393;
- border-right-color: #939393;
- border-left-color: #939393;
- border-top-width: 1px;
- border-right-width: 1px;
- border-left-width: 1px;
- border-top-style: solid;
- border-right-style: solid;
- border-left-style: solid;
- float: left;
- display: none;
-}
-.codeSnippetContainerTabSingle {
- background: #f8f8f8;
- padding: 2px 15px 0px 15px;
- width: auto;
- height: 20px;
- color: #000000;
- font-family: "Segoe UI" , "Lucida Grande" , Verdana, Arial, Helvetica, sans-serif !important;
- font-size: 12px;
- font-weight: bold;
- font-style: normal !important;
- vertical-align: baseline;
- border-top-color: #939393;
- border-right-color: #939393;
- border-left-color: #939393;
- border-top-width: 1px;
- border-right-width: 1px;
- border-left-width: 1px;
- border-top-style: solid;
- border-right-style: solid;
- border-left-style: solid;
- float: left;
-}
-.codeSnippetContainerTab a {
- top: 2px;
- color: #000000;
- font-weight: bold;
- text-decoration: none;
- position: relative;
-}
-.codeSnippetContainerTab a:link {
- color: #000000;
-}
-.codeSnippetContainerTab a:hover {
- color: #136460;
-}
-.codeSnippetContainerTabActive a {
- top: 2px;
- color: #000000;
- font-weight: bold;
- text-decoration: none;
- position: relative;
- cursor: default;
-}
-.codeSnippetContainerTabActive a:link {
- color: #000000;
-}
-.codeSnippetContainerTabActive a:hover {
- color: #000000;
-}
-.codeSnippetContainerTabPhantom a {
- top: 2px;
- color: #000000;
- font-weight: bold;
- text-decoration: none;
- position: relative;
- cursor: default;
-}
-.codeSnippetContainerTabPhantom a:link {
- color: #000000;
-}
-.codeSnippetContainerCodeContainer {
- border: 1px solid #939393;
- top: -1px;
- margin-bottom: 12px;
- position: relative;
-}
-.codeSnippetToolBar {
- width: auto;
- height: auto;
-}
-.codeSnippetToolBarText {
- top: -8px;
- width: auto;
- height: 0px;
- padding-right: 0px;
- padding-left: 0px;
- vertical-align: top;
- float: right;
- position: relative;
-}
-.codeSnippetToolBarText a {
- color: #1364c4;
- text-decoration: none;
- padding-left: 8px;
- padding-right: 8px;
- font-family: "Segoe UI" , "Lucida Grande" , Verdana, Arial, Helvetica, sans-serif !important;
- font-size: 10px;
- font-style: normal !important;
- text-decoration: none;
- margin-right: 10px;
- margin-left: 0px;
- background-color: #ffffff;
-}
-.codeSnippetToolBarText a:link {
- color: #1364c4;
-}
-.codeSnippetContainerCode {
- margin: 0px;
- padding: 10px;
- width: auto;
-}
-.codeSnippetContainerCode div {
- margin: 0px;
- padding: 0px;
-}
-.codeSnippetContainerCode pre {
- margin: 0px;
- padding: 5px;
- overflow: auto;
- font-family: Consolas, Courier, monospace !important;
- font-style: normal;
- font-weight: normal;
- -ms-word-wrap: normal;
-}
-.codeSnippetContainerCode .keyword {
- color: #0000ff;
- font-weight: normal;
-}
-
-.copyCodeSnippet {
-}
-
-/* Keyword and phrase styles */
-span.code, span.command {
- font-family: Consolas, Courier, monospace;
- color: #000066;
- background-color: #f4f4f4;
-}
-span.ui {
- font-weight: bold;
-}
-span.math {
- font-style: italic;
-}
-span.input {
- font-weight: bold;
-}
-span.term {
- font-style: italic;
-}
-span.label {
- font-weight: bold;
-}
-span.foreignPhrase, span.phrase {
- font-style: italic;
-}
-span.placeholder {
- font-style: italic;
-}
-span.typeparameter {
- font-style: italic;
-}
-span.identifier {
-}
-span.keyword {
- font-weight: bold;
-}
-span.parameter {
- font-style: italic;
-}
-dt span.parameter {
- font-weight: normal;
-}
-span.literal, span.literalValue {
- color: #cc0000;
-}
-span.comment {
- color: #006633;
-}
-span.introStyle {
- color: #a9a9a9;
-}
-span.nolink {
- font-weight: bold;
-}
-
-/* Auto-outline styles */
-ul.autoOutline {
-}
-li.outlineSectionEntry {
-}
-div.outlineSectionEntrySummary {
-}
-
-/* Media styles */
-div.mediaNear {
- text-align: left;
- margin-top: 1em;
- margin-bottom: 1em;
-}
-div.mediaFar {
- text-align: right;
- margin-top: 1em;
- margin-bottom: 1em;
-}
-div.mediaCenter {
- text-align: center;
- margin-top: 1em;
- margin-bottom: 1em;
-}
-span.captionLead {
- font-weight: bold;
- margin-right: .5em;
-}
-span.media img {
- vertical-align: top;
-}
-
-/* Glossary styles */
-div.glossaryDiv {
-}
-div.glossaryLetterBar {
-}
-hr.glossaryRule {
-}
-h3.glossaryGroupHeading {
- color: #808080;
-}
-div.glossaryGroup {
-}
-dl.glossaryGroupList {
- margin: 0;
- color: Black;
-}
-dt.glossaryEntry {
- margin-left: 2em;
-}
-dd.glossaryEntry {
- margin-left: 2em;
- margin-bottom: 2em;
-}
-div.relatedEntry {
- margin-bottom: 4px;
-}
-
-/* Bibliography styles */
-div.bibliographStyle {
- padding-top: 5px;
-}
-span.bibliographyNumber {
-}
-span.bibliographyAuthor {
- font-weight: bold;
-}
-span.bibliographyTitle {
- font-style: italic;
-}
-span.bibliographyPublisher {
-}
-sup.citation a:link a:visited a:active {
- text-decoration: none;
-}
-
-/* Placeholder for the Help 1 user data style class */
-.userDataStyle {
-}
-
-
-
-.missing
-{
- color: #dc143c;
- font-size: 8.5pt;
- font-weight: bold;
-}
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/highlight.css b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/highlight.css
deleted file mode 100644
index 2916c31c3..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/styles/highlight.css
+++ /dev/null
@@ -1,28 +0,0 @@
-.highlight-inline { color: #000066; font-size: 9pt; font-family: Consolas, "Courier New", Courier, monospace; }
-.highlight-pre { clear: both; width: 99.5%; background-color: #EFEFF7; padding: 0.4em; font-size: 9pt; font-family: Consolas, "Courier New", Courier, monospace; margin-top: 0px; margin-bottom: 1em; }
-.highlight-comment { color: #006633; }
-.highlight-literal { color: #CC0000; }
-.highlight-number { color: #009966; }
-.highlight-keyword { color: #0000FF; }
-.highlight-preprocessor { color: #996666; }
-.highlight-xml-tag { color: #AA4400 }
-.highlight-xml-bracket { color: #0000FF }
-.highlight-xml-bracket-inline { background: #FFFF66 }
-.highlight-xml-comment { color: #006633 }
-.highlight-xml-cdata { color: #AA0088 }
-.highlight-xml-attribute-name { color: #0000FF }
-.highlight-xml-attribute-equal { color: #000000 }
-.highlight-xml-attribute-value {color: #CC0000 }
-.highlight-title { font-weight: bold; margin-top: 1em; margin-bottom: 2px; border-bottom: gray 1px solid; padding-bottom: 3px; }
-.highlight-copycode { float: right; padding-right: 10px; font-weight: normal; cursor: pointer; }
-.highlight-copycode_h { float: right; padding-right: 10px; font-weight: normal; cursor: pointer; text-decoration: underline}
-.highlight-lineno { font-size: 80%; color: black }
-.highlight-lnborder { border-right-style: solid; border-right-width: 1px; border-color: gray; padding-right: 4px; margin-right: 4px; width: 4px;}
-.highlight-spacer { padding-right: 20px; }
-.highlight-spacerShort { padding-right: 5px; }
-.highlight-collapsebox { cursor: pointer; color: black; text-align: center; border-style: solid; border-width: 1px; border-color: gray; margin-left: 2px; margin-right: 5px; }
-.highlight-collapsed { border-style: solid; border-width: 1px; border-color: gray; margin: 2px; color: gray; }
-.highlight-expanded { border-left-style: solid; border-left-width: 1px; border-color: gray; margin-left: 2px; margin-right: 10px; }
-.highlight-endblock { border-left-style: solid; border-left-width: 1px; border-bottom-style: solid; border-bottom-width: 1px; border-color: gray; margin-left: 2px; margin-right: 10px; }
-.highlight-pshell-cmdlet { color: #5A9EA5; font-weight: bold; }
-.highlight-namespace { color: #008284; }
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/00382765-2e26-f538-4a2d-b2485efd1a8e.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/00382765-2e26-f538-4a2d-b2485efd1a8e.xml
deleted file mode 100644
index cc5840d1f..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/00382765-2e26-f538-4a2d-b2485efd1a8e.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/024bfd5b-b503-081f-f322-bba29b0db820.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/024bfd5b-b503-081f-f322-bba29b0db820.xml
deleted file mode 100644
index ad50e1f3d..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/024bfd5b-b503-081f-f322-bba29b0db820.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/034ae87e-3b08-4832-3d16-21f20a6e540f.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/034ae87e-3b08-4832-3d16-21f20a6e540f.xml
deleted file mode 100644
index ca17fc779..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/034ae87e-3b08-4832-3d16-21f20a6e540f.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/059ea426-8283-f2ce-2fe8-a888fb9dfcc6.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/059ea426-8283-f2ce-2fe8-a888fb9dfcc6.xml
deleted file mode 100644
index 979cbfbae..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/059ea426-8283-f2ce-2fe8-a888fb9dfcc6.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/096e6ff0-87d8-1e79-18f5-203f368fc5e8.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/096e6ff0-87d8-1e79-18f5-203f368fc5e8.xml
deleted file mode 100644
index c6dbc878c..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/096e6ff0-87d8-1e79-18f5-203f368fc5e8.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/09b1326f-d20c-fb04-9f6b-df23ec45a175.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/09b1326f-d20c-fb04-9f6b-df23ec45a175.xml
deleted file mode 100644
index b4bde87ad..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/09b1326f-d20c-fb04-9f6b-df23ec45a175.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/09c64b73-29db-e275-a4af-2731ed091dc5.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/09c64b73-29db-e275-a4af-2731ed091dc5.xml
deleted file mode 100644
index 532a62f1f..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/09c64b73-29db-e275-a4af-2731ed091dc5.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/0bc0206d-0724-3891-b8d5-51c48abff2eb.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/0bc0206d-0724-3891-b8d5-51c48abff2eb.xml
deleted file mode 100644
index 3b867f940..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/0bc0206d-0724-3891-b8d5-51c48abff2eb.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/0e9009a8-cfed-c48e-51ad-e8d7d2dbd8d3.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/0e9009a8-cfed-c48e-51ad-e8d7d2dbd8d3.xml
deleted file mode 100644
index 11ce24d3e..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/0e9009a8-cfed-c48e-51ad-e8d7d2dbd8d3.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/144078bd-d1ad-bece-4daa-7fdd3a7ed7dc.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/144078bd-d1ad-bece-4daa-7fdd3a7ed7dc.xml
deleted file mode 100644
index 94ba75d7c..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/144078bd-d1ad-bece-4daa-7fdd3a7ed7dc.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/1480a26f-ba4e-6757-f81e-a750cb6e84be.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/1480a26f-ba4e-6757-f81e-a750cb6e84be.xml
deleted file mode 100644
index 3d045837d..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/1480a26f-ba4e-6757-f81e-a750cb6e84be.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/19b5d1da-767b-33fa-2450-d623c55c4fc0.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/19b5d1da-767b-33fa-2450-d623c55c4fc0.xml
deleted file mode 100644
index dc41ed415..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/19b5d1da-767b-33fa-2450-d623c55c4fc0.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/1b52f8e5-8c07-3f7e-4cd0-00ab1b21b3df.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/1b52f8e5-8c07-3f7e-4cd0-00ab1b21b3df.xml
deleted file mode 100644
index 704d4b8b9..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/1b52f8e5-8c07-3f7e-4cd0-00ab1b21b3df.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/1cf4ec89-2692-7736-8791-f42cacc3c7d7.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/1cf4ec89-2692-7736-8791-f42cacc3c7d7.xml
deleted file mode 100644
index 7d741b23b..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/1cf4ec89-2692-7736-8791-f42cacc3c7d7.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/1e04daa1-5f80-6b39-c037-265c793bd6b8.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/1e04daa1-5f80-6b39-c037-265c793bd6b8.xml
deleted file mode 100644
index 86a0d284e..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/1e04daa1-5f80-6b39-c037-265c793bd6b8.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/229e1980-ce7c-a4b5-01e0-d73c4a4183ec.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/229e1980-ce7c-a4b5-01e0-d73c4a4183ec.xml
deleted file mode 100644
index f75860098..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/229e1980-ce7c-a4b5-01e0-d73c4a4183ec.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/2664d667-ed19-c646-54ed-c9db2d9ad553.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/2664d667-ed19-c646-54ed-c9db2d9ad553.xml
deleted file mode 100644
index c5e7539c0..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/2664d667-ed19-c646-54ed-c9db2d9ad553.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/29287a92-5040-ef0a-3012-74071dbb18f6.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/29287a92-5040-ef0a-3012-74071dbb18f6.xml
deleted file mode 100644
index d348c487b..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/29287a92-5040-ef0a-3012-74071dbb18f6.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/2adefda4-0a38-b90a-4c33-ec6bcab66e8d.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/2adefda4-0a38-b90a-4c33-ec6bcab66e8d.xml
deleted file mode 100644
index b241539cf..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/2adefda4-0a38-b90a-4c33-ec6bcab66e8d.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/2ee602f5-69fd-21ac-a1ad-e010a4708da4.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/2ee602f5-69fd-21ac-a1ad-e010a4708da4.xml
deleted file mode 100644
index 74f130885..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/2ee602f5-69fd-21ac-a1ad-e010a4708da4.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/338e1130-f4c3-67b5-3977-34f5c2813f12.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/338e1130-f4c3-67b5-3977-34f5c2813f12.xml
deleted file mode 100644
index ed45e6eef..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/338e1130-f4c3-67b5-3977-34f5c2813f12.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/369e6aa6-f96f-f4dd-06f2-7560309f8ca1.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/369e6aa6-f96f-f4dd-06f2-7560309f8ca1.xml
deleted file mode 100644
index 2482cb9d0..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/369e6aa6-f96f-f4dd-06f2-7560309f8ca1.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/38c4b637-b07c-3339-19a3-c93c778f64f3.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/38c4b637-b07c-3339-19a3-c93c778f64f3.xml
deleted file mode 100644
index bc9b1dce3..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/38c4b637-b07c-3339-19a3-c93c778f64f3.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/3c0f5b0c-c3a6-cf67-bf11-b7997ecc1d2b.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/3c0f5b0c-c3a6-cf67-bf11-b7997ecc1d2b.xml
deleted file mode 100644
index 32e02e607..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/3c0f5b0c-c3a6-cf67-bf11-b7997ecc1d2b.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/3ccebd50-94d3-b01b-5152-602a96eba478.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/3ccebd50-94d3-b01b-5152-602a96eba478.xml
deleted file mode 100644
index 3cc595ba1..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/3ccebd50-94d3-b01b-5152-602a96eba478.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/3f310d0d-47d1-c5af-63bf-2bb2cd48f9dc.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/3f310d0d-47d1-c5af-63bf-2bb2cd48f9dc.xml
deleted file mode 100644
index f648174c0..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/3f310d0d-47d1-c5af-63bf-2bb2cd48f9dc.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/4604db99-bf8f-7e67-5c9b-d23c5b8cd3f8.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/4604db99-bf8f-7e67-5c9b-d23c5b8cd3f8.xml
deleted file mode 100644
index eec77d2b0..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/4604db99-bf8f-7e67-5c9b-d23c5b8cd3f8.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/4771be47-ef15-eabc-87a7-18df1bc57ee1.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/4771be47-ef15-eabc-87a7-18df1bc57ee1.xml
deleted file mode 100644
index 4b9867f2d..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/4771be47-ef15-eabc-87a7-18df1bc57ee1.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/4f801c37-c1cf-e3cf-a94f-339d3778e54f.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/4f801c37-c1cf-e3cf-a94f-339d3778e54f.xml
deleted file mode 100644
index b2c6eea62..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/4f801c37-c1cf-e3cf-a94f-339d3778e54f.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/4fc51792-2e11-7c78-6601-69b6194e7236.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/4fc51792-2e11-7c78-6601-69b6194e7236.xml
deleted file mode 100644
index a31e932d7..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/4fc51792-2e11-7c78-6601-69b6194e7236.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/4fcb74af-e8be-d74c-c3c0-9ea78251a06b.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/4fcb74af-e8be-d74c-c3c0-9ea78251a06b.xml
deleted file mode 100644
index abf32e7b0..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/4fcb74af-e8be-d74c-c3c0-9ea78251a06b.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/502b87ce-612e-3be3-2f65-ba7e3e6b1b18.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/502b87ce-612e-3be3-2f65-ba7e3e6b1b18.xml
deleted file mode 100644
index 2db089063..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/502b87ce-612e-3be3-2f65-ba7e3e6b1b18.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/52258a68-c6cd-eb94-f06c-ff2564b46af9.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/52258a68-c6cd-eb94-f06c-ff2564b46af9.xml
deleted file mode 100644
index dcb2af55c..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/52258a68-c6cd-eb94-f06c-ff2564b46af9.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/5322a78d-cbe3-7e65-f001-78f5dadfe009.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/5322a78d-cbe3-7e65-f001-78f5dadfe009.xml
deleted file mode 100644
index eba8d9200..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/5322a78d-cbe3-7e65-f001-78f5dadfe009.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/538022bc-a0ba-e89d-99bc-b9a9a313d75d.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/538022bc-a0ba-e89d-99bc-b9a9a313d75d.xml
deleted file mode 100644
index 602dc45bf..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/538022bc-a0ba-e89d-99bc-b9a9a313d75d.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/53c2e70f-f99b-222f-951d-99d38056ec33.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/53c2e70f-f99b-222f-951d-99d38056ec33.xml
deleted file mode 100644
index 9371feb65..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/53c2e70f-f99b-222f-951d-99d38056ec33.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/55a6c83e-c581-8ac9-f803-434224d5fbc6.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/55a6c83e-c581-8ac9-f803-434224d5fbc6.xml
deleted file mode 100644
index 575718ac9..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/55a6c83e-c581-8ac9-f803-434224d5fbc6.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/58a7de95-1c6b-378b-31e1-88789cce70b0.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/58a7de95-1c6b-378b-31e1-88789cce70b0.xml
deleted file mode 100644
index 4815fbae9..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/58a7de95-1c6b-378b-31e1-88789cce70b0.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/58c07e13-ecda-5b51-166e-30c41e312af7.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/58c07e13-ecda-5b51-166e-30c41e312af7.xml
deleted file mode 100644
index aae722de7..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/58c07e13-ecda-5b51-166e-30c41e312af7.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/5aba9200-bd4e-f860-8d36-0afe892d923e.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/5aba9200-bd4e-f860-8d36-0afe892d923e.xml
deleted file mode 100644
index 7778a97a9..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/5aba9200-bd4e-f860-8d36-0afe892d923e.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/5abed614-073a-f031-8a3b-e7a9bb4b424a.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/5abed614-073a-f031-8a3b-e7a9bb4b424a.xml
deleted file mode 100644
index c02c5538e..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/5abed614-073a-f031-8a3b-e7a9bb4b424a.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/5df0a6ee-f8a7-59ba-5ca8-0972aade618b.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/5df0a6ee-f8a7-59ba-5ca8-0972aade618b.xml
deleted file mode 100644
index 1dfd2116b..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/5df0a6ee-f8a7-59ba-5ca8-0972aade618b.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/60cf4e3d-b957-8668-65f6-d6c4150f6480.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/60cf4e3d-b957-8668-65f6-d6c4150f6480.xml
deleted file mode 100644
index 4723f9f09..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/60cf4e3d-b957-8668-65f6-d6c4150f6480.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/60f75a32-d2a6-3473-c73a-ce56c1b18051.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/60f75a32-d2a6-3473-c73a-ce56c1b18051.xml
deleted file mode 100644
index 1454ce753..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/60f75a32-d2a6-3473-c73a-ce56c1b18051.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/657799f7-4fc6-c4f4-dd51-1381a708d6b1.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/657799f7-4fc6-c4f4-dd51-1381a708d6b1.xml
deleted file mode 100644
index 9c35a4f02..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/657799f7-4fc6-c4f4-dd51-1381a708d6b1.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/7199abad-ffd3-d84e-a9b5-87e29c1da288.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/7199abad-ffd3-d84e-a9b5-87e29c1da288.xml
deleted file mode 100644
index 6d4fdaf0b..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/7199abad-ffd3-d84e-a9b5-87e29c1da288.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/737f1217-f4a7-2b71-0afe-51f2c079f4ad.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/737f1217-f4a7-2b71-0afe-51f2c079f4ad.xml
deleted file mode 100644
index 2136e3de8..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/737f1217-f4a7-2b71-0afe-51f2c079f4ad.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/759a2119-4b7a-6819-4b57-103452d73ce7.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/759a2119-4b7a-6819-4b57-103452d73ce7.xml
deleted file mode 100644
index 18a82ded3..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/759a2119-4b7a-6819-4b57-103452d73ce7.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/7aecbfa8-8b16-a50a-29fe-7214fbc5aa63.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/7aecbfa8-8b16-a50a-29fe-7214fbc5aa63.xml
deleted file mode 100644
index 692159232..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/7aecbfa8-8b16-a50a-29fe-7214fbc5aa63.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/7cc37a25-17e5-34f7-e023-83576a9f15ff.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/7cc37a25-17e5-34f7-e023-83576a9f15ff.xml
deleted file mode 100644
index bd327988e..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/7cc37a25-17e5-34f7-e023-83576a9f15ff.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/7f35c3c4-5195-a494-b036-04afaa2225a6.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/7f35c3c4-5195-a494-b036-04afaa2225a6.xml
deleted file mode 100644
index 023d8b89e..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/7f35c3c4-5195-a494-b036-04afaa2225a6.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/844c188b-1abe-ae61-9fed-3bcfa67f1147.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/844c188b-1abe-ae61-9fed-3bcfa67f1147.xml
deleted file mode 100644
index 92fec0f23..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/844c188b-1abe-ae61-9fed-3bcfa67f1147.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/897c5927-6102-febf-7b76-c0e9a179886f.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/897c5927-6102-febf-7b76-c0e9a179886f.xml
deleted file mode 100644
index 7612553d4..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/897c5927-6102-febf-7b76-c0e9a179886f.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/8a0191e5-d3df-a99b-f4b2-a995106fd951.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/8a0191e5-d3df-a99b-f4b2-a995106fd951.xml
deleted file mode 100644
index e332077dc..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/8a0191e5-d3df-a99b-f4b2-a995106fd951.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/8ae68a72-152c-5428-1973-60844a869bae.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/8ae68a72-152c-5428-1973-60844a869bae.xml
deleted file mode 100644
index 8cfd7fca2..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/8ae68a72-152c-5428-1973-60844a869bae.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/8c6db65a-0c75-1a36-f23f-4d0e58deef00.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/8c6db65a-0c75-1a36-f23f-4d0e58deef00.xml
deleted file mode 100644
index 7a01df1ef..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/8c6db65a-0c75-1a36-f23f-4d0e58deef00.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/8c9e6389-18cd-6269-6181-8b148678cfa9.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/8c9e6389-18cd-6269-6181-8b148678cfa9.xml
deleted file mode 100644
index 8be1fb141..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/8c9e6389-18cd-6269-6181-8b148678cfa9.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/8d5eb1b0-1ad8-5617-e4e0-519da559cf82.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/8d5eb1b0-1ad8-5617-e4e0-519da559cf82.xml
deleted file mode 100644
index 774ecf3ab..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/8d5eb1b0-1ad8-5617-e4e0-519da559cf82.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/9252fe17-2fa4-d444-db5a-4a2a3adaa51f.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/9252fe17-2fa4-d444-db5a-4a2a3adaa51f.xml
deleted file mode 100644
index ffd240251..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/9252fe17-2fa4-d444-db5a-4a2a3adaa51f.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/97aa85dd-7d55-7d4a-d16c-6151057d4e14.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/97aa85dd-7d55-7d4a-d16c-6151057d4e14.xml
deleted file mode 100644
index f72a708d1..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/97aa85dd-7d55-7d4a-d16c-6151057d4e14.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/9b5fa748-b4ab-02b4-f774-8656cb55168f.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/9b5fa748-b4ab-02b4-f774-8656cb55168f.xml
deleted file mode 100644
index 61546b438..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/9b5fa748-b4ab-02b4-f774-8656cb55168f.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/a05fe883-3a66-89c9-9fce-6ea5c8d8d8d5.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/a05fe883-3a66-89c9-9fce-6ea5c8d8d8d5.xml
deleted file mode 100644
index 2340e9187..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/a05fe883-3a66-89c9-9fce-6ea5c8d8d8d5.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/a2968e7a-28c6-4e4a-97a7-bd7ce4b74499.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/a2968e7a-28c6-4e4a-97a7-bd7ce4b74499.xml
deleted file mode 100644
index 19200fb61..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/a2968e7a-28c6-4e4a-97a7-bd7ce4b74499.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/a5ecbe15-aade-af7f-4860-6c5c412a34b4.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/a5ecbe15-aade-af7f-4860-6c5c412a34b4.xml
deleted file mode 100644
index 835d56156..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/a5ecbe15-aade-af7f-4860-6c5c412a34b4.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/a8ba3814-05f4-78f5-3342-df80bc14992c.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/a8ba3814-05f4-78f5-3342-df80bc14992c.xml
deleted file mode 100644
index 2a1bec047..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/a8ba3814-05f4-78f5-3342-df80bc14992c.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/bd57e5da-91f3-3386-eb56-0945ca4e6df8.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/bd57e5da-91f3-3386-eb56-0945ca4e6df8.xml
deleted file mode 100644
index 151885618..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/bd57e5da-91f3-3386-eb56-0945ca4e6df8.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/c1be0fc8-f6e4-6bfe-4da7-329414bf8359.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/c1be0fc8-f6e4-6bfe-4da7-329414bf8359.xml
deleted file mode 100644
index c727e00f9..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/c1be0fc8-f6e4-6bfe-4da7-329414bf8359.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/c2dce7cc-70cd-a723-4b0c-60aa5478cade.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/c2dce7cc-70cd-a723-4b0c-60aa5478cade.xml
deleted file mode 100644
index 218298f5e..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/c2dce7cc-70cd-a723-4b0c-60aa5478cade.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/c49f9809-5da8-58fb-8339-86c7093be0a8.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/c49f9809-5da8-58fb-8339-86c7093be0a8.xml
deleted file mode 100644
index 8c59df113..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/c49f9809-5da8-58fb-8339-86c7093be0a8.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/ca3a380a-0fe3-cea2-0107-f7ca1d5bd9fe.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/ca3a380a-0fe3-cea2-0107-f7ca1d5bd9fe.xml
deleted file mode 100644
index 0b23d2c4c..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/ca3a380a-0fe3-cea2-0107-f7ca1d5bd9fe.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/cb8166eb-490f-ac7a-3759-9bf25cd3c1e3.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/cb8166eb-490f-ac7a-3759-9bf25cd3c1e3.xml
deleted file mode 100644
index 77986954e..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/cb8166eb-490f-ac7a-3759-9bf25cd3c1e3.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/cc0ffba1-1feb-5351-ec86-dd9d01bb025c.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/cc0ffba1-1feb-5351-ec86-dd9d01bb025c.xml
deleted file mode 100644
index 7fb75558b..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/cc0ffba1-1feb-5351-ec86-dd9d01bb025c.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/cde853fb-e83a-0911-6f76-7f04e385b62c.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/cde853fb-e83a-0911-6f76-7f04e385b62c.xml
deleted file mode 100644
index 57066c88e..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/cde853fb-e83a-0911-6f76-7f04e385b62c.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/d6a52ff1-1fd8-e1b3-b372-61d314a78d5e.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/d6a52ff1-1fd8-e1b3-b372-61d314a78d5e.xml
deleted file mode 100644
index 046dd6eb7..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/d6a52ff1-1fd8-e1b3-b372-61d314a78d5e.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/dde5b439-ba6c-42bd-a39d-e163271019dd.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/dde5b439-ba6c-42bd-a39d-e163271019dd.xml
deleted file mode 100644
index c2d673081..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/dde5b439-ba6c-42bd-a39d-e163271019dd.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/de47654c-7ae4-9302-3061-ea6307706cb8.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/de47654c-7ae4-9302-3061-ea6307706cb8.xml
deleted file mode 100644
index f00ef7f3f..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/de47654c-7ae4-9302-3061-ea6307706cb8.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/e050a329-ded5-b6ad-bee5-bdcb2a97c5ee.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/e050a329-ded5-b6ad-bee5-bdcb2a97c5ee.xml
deleted file mode 100644
index 2a39f24cf..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/e050a329-ded5-b6ad-bee5-bdcb2a97c5ee.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/e342c1b4-0ab2-9ff9-bbcb-78004b2d924d.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/e342c1b4-0ab2-9ff9-bbcb-78004b2d924d.xml
deleted file mode 100644
index 9b1ae19e4..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/e342c1b4-0ab2-9ff9-bbcb-78004b2d924d.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/e7f88c42-6076-1782-76c7-7f00bb2ba6b4.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/e7f88c42-6076-1782-76c7-7f00bb2ba6b4.xml
deleted file mode 100644
index d9d51ca2a..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/e7f88c42-6076-1782-76c7-7f00bb2ba6b4.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/e8054e46-4edd-0108-00f6-0af9ce5918b9.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/e8054e46-4edd-0108-00f6-0af9ce5918b9.xml
deleted file mode 100644
index e1bdbb352..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/e8054e46-4edd-0108-00f6-0af9ce5918b9.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/ebe0037e-4a11-896a-6db2-f3601e9fba51.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/ebe0037e-4a11-896a-6db2-f3601e9fba51.xml
deleted file mode 100644
index d351e986f..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/ebe0037e-4a11-896a-6db2-f3601e9fba51.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/ed7f1515-c1bd-5914-ff3d-a11c448e1288.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/ed7f1515-c1bd-5914-ff3d-a11c448e1288.xml
deleted file mode 100644
index c20e67345..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/ed7f1515-c1bd-5914-ff3d-a11c448e1288.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/ed8ecef6-0089-eab6-3c3c-e76b190ea7e8.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/ed8ecef6-0089-eab6-3c3c-e76b190ea7e8.xml
deleted file mode 100644
index bfb47a514..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/ed8ecef6-0089-eab6-3c3c-e76b190ea7e8.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/ee19ea95-08a2-85c3-0e1a-7c0ac93345dd.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/ee19ea95-08a2-85c3-0e1a-7c0ac93345dd.xml
deleted file mode 100644
index 4dd00f65f..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/ee19ea95-08a2-85c3-0e1a-7c0ac93345dd.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/eeb7efeb-654f-1951-4973-cf8d1430fd87.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/eeb7efeb-654f-1951-4973-cf8d1430fd87.xml
deleted file mode 100644
index 5430cf3a5..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/eeb7efeb-654f-1951-4973-cf8d1430fd87.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f3787db5-ab98-db68-694e-94d2ddd8b140.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f3787db5-ab98-db68-694e-94d2ddd8b140.xml
deleted file mode 100644
index 3073a6c98..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f3787db5-ab98-db68-694e-94d2ddd8b140.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f4706713-1212-b813-600c-468d1315876e.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f4706713-1212-b813-600c-468d1315876e.xml
deleted file mode 100644
index 6516561cf..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f4706713-1212-b813-600c-468d1315876e.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f553b938-f70f-c9bd-8e29-682200413e96.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f553b938-f70f-c9bd-8e29-682200413e96.xml
deleted file mode 100644
index 2b10b09c7..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f553b938-f70f-c9bd-8e29-682200413e96.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f6fd3b5a-3d2f-fc65-c489-4d161f6f3072.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f6fd3b5a-3d2f-fc65-c489-4d161f6f3072.xml
deleted file mode 100644
index 7e8c017ea..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f6fd3b5a-3d2f-fc65-c489-4d161f6f3072.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f7d5f52e-c819-340a-3fc4-9aa80263945a.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f7d5f52e-c819-340a-3fc4-9aa80263945a.xml
deleted file mode 100644
index 938e3784f..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f7d5f52e-c819-340a-3fc4-9aa80263945a.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f8bf2a0a-9a63-8a01-4591-a46c51a49245.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f8bf2a0a-9a63-8a01-4591-a46c51a49245.xml
deleted file mode 100644
index 03204b981..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/f8bf2a0a-9a63-8a01-4591-a46c51a49245.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/fbeffa2b-5391-c0ef-59a5-cff1df0eb0b4.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/fbeffa2b-5391-c0ef-59a5-cff1df0eb0b4.xml
deleted file mode 100644
index e9df6960b..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/fbeffa2b-5391-c0ef-59a5-cff1df0eb0b4.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/roottoc.xml b/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/roottoc.xml
deleted file mode 100644
index 3c351a3ee..000000000
--- a/doc/System.Linq.Dynamic.Core.SandCastle/wwwroot/toc/roottoc.xml
+++ /dev/null
@@ -1 +0,0 @@
-
\ No newline at end of file
diff --git a/doc/System.Linq.Dynamic.Core.shfbproj b/doc/System.Linq.Dynamic.Core.shfbproj
deleted file mode 100644
index 47ff44704..000000000
--- a/doc/System.Linq.Dynamic.Core.shfbproj
+++ /dev/null
@@ -1,128 +0,0 @@
-
-
-
-
- Debug
- AnyCPU
- 2.0
- {591f9224-a8d6-49cf-8af8-f9b383c1f9ff}
- 2017.9.26.0
-
- Documentation
- Documentation
- Documentation
-
- Cross-platform (.NET Core/.NET Standard)
- ..\docs\
- Documentation
- en-US
- 100
- OnlyWarningsAndErrors
- Website
- False
- False
- False
- True
-
-
-
-
-
-
-
-
- Msdn
- Msdn
- False
- True
-
- This is a .NET Core port of the the Microsoft assembly for the .Net 4.0 Dynamic language functionality.
- Interface for providing custom types for Dynamic Linq. (Like custom enums.)
- All exceptions are defined here
- Dynamic Linq extensions for EntityFramework which adds Async support
- Dynamic Linq extensions for Microsoft.EntityFrameworkCore which adds Async support
-
- 1.0.0.0
- 2
- False
- C#
- Blank
- False
- VS2013
- False
- Guid
- System.Linq.Dynamic.Core, EntityFramework.DynamicLinq and Microsoft.EntityFrameworkCore.DynamicLinq
- BelowNamespaces
-
-
- InheritedMembers, InheritedFrameworkMembers, Protected, ProtectedInternalAsProtected, PublicCompilerGenerated, EditorBrowsableNever, NonBrowsable
- False
-
-
-
-
- {@HelpFormatOutputPaths}
-
-
-
-
-
-
-
-
-
- {@SyntaxFilters}
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
- OnBuildSuccess
-
-
\ No newline at end of file
diff --git a/docfx/build-docs.ps1 b/docfx/build-docs.ps1
new file mode 100644
index 000000000..838faae6f
--- /dev/null
+++ b/docfx/build-docs.ps1
@@ -0,0 +1,31 @@
+<#
+.SYNOPSIS
+ Builds documentation for this project into static HTML output
+
+.NOTES
+ Author: Stef Heyenrath - @sheyenrath
+
+.LINK
+ https://github.com/StefH/System.Linq.Dynamic.Core/docfx
+ https://raw.githubusercontent.com/jsiegmund/docfx-seed/master/build-docs.ps1
+#>
+
+# For running this script: "Set-ExecutionPolicy Bypass"
+
+param (
+ [Switch]$Serve = $false
+)
+
+Write-Host "Starting docfx build process." -ForegroundColor Yellow
+
+$docfxArgs = @(
+ "docfx.json"
+)
+
+# Add '--serve' to arguments in order to start serving the site in place
+if ($Serve.IsPresent) {
+ $docfxArgs = $docfxArgs + "--serve"
+}
+
+# Start the make process which uses Sphynx to convert RST to HTML
+Start-Process "docfx" -ArgumentList $docfxArgs -NoNewWindow -Wait
\ No newline at end of file
diff --git a/docfx/docfx.json b/docfx/docfx.json
new file mode 100644
index 000000000..ff6933a05
--- /dev/null
+++ b/docfx/docfx.json
@@ -0,0 +1,45 @@
+{
+ "metadata": [
+ {
+ "src": [
+ {
+ "files": [ "**/System.Linq.Dynamic.Core.csproj" ],
+ "exclude": [ "**/bin/**", "**/obj/**" ],
+ "src": "../src"
+ }
+ ],
+ "dest": "obj/api"
+ }
+ ],
+ "build": {
+ "maxParallelism": 2,
+ "content": [
+ {
+ "files": [ "**/*.yml" ],
+ "src": "obj/api",
+ "dest": "api"
+ },
+ {
+ "files": [ "*.md", "toc.yml" ]
+ }
+ ],
+ "resource": [
+ {
+ "files": [ ]
+ }
+ ],
+ "overwrite": [
+ {
+ "files": [
+ "apidoc/*.yml"
+ ]
+ }
+ ],
+ "globalMetadata": {
+ "_enableSearch": true
+ },
+ "markdownEngineName": "markdig",
+ "dest": "../docs",
+ "xrefService": [ "https://xref.docs.microsoft.com/query?uid={uid}" ]
+ }
+}
\ No newline at end of file
diff --git a/docfx/howto.txt b/docfx/howto.txt
new file mode 100644
index 000000000..209f7559b
--- /dev/null
+++ b/docfx/howto.txt
@@ -0,0 +1,3 @@
+1. choco install docfx -y
+
+2. Run powershell script: ./build-docs.ps1 -serve
diff --git a/docfx/index.md b/docfx/index.md
new file mode 100644
index 000000000..ca7199ece
--- /dev/null
+++ b/docfx/index.md
@@ -0,0 +1,14 @@
+# System.Linq.Dynamic.Core
+This is a **.NET Core / Standard port** of the Microsoft assembly for the .Net 4.0 Dynamic language functionality.
+
+# Overview
+With this library it's possible to write Dynamic LINQ queries (string based) on an `IQueryable`:
+``` c#
+var query = db.Customers
+ .Where("City == @0 and Orders.Count >= @1", "London", 10)
+ .OrderBy("CompanyName")
+ .Select("new(CompanyName as Name, Phone)");
+```
+
+# API Documentation
+See [this link](api/System.Linq.Dynamic.Core.html).
diff --git a/docfx/toc.yml b/docfx/toc.yml
new file mode 100644
index 000000000..cea91b3dc
--- /dev/null
+++ b/docfx/toc.yml
@@ -0,0 +1,4 @@
+- name: Home
+ href: index.md
+- name: API Documentation
+ href: obj/api/
\ No newline at end of file
diff --git a/docs/SearchHelp.aspx b/docs/SearchHelp.aspx
deleted file mode 100644
index 6e2a17b6a..000000000
--- a/docs/SearchHelp.aspx
+++ /dev/null
@@ -1,233 +0,0 @@
-<%@ Page Language="C#" EnableViewState="False" %>
-
-
diff --git a/docs/SearchHelp.inc.php b/docs/SearchHelp.inc.php
deleted file mode 100644
index b905e130c..000000000
--- a/docs/SearchHelp.inc.php
+++ /dev/null
@@ -1,173 +0,0 @@
-
-// Contributed to the Sandcastle Help File Builder project by Thomas Levesque
-
-class Ranking
-{
- public $filename;
- public $pageTitle;
- public $rank;
-
- function __construct($file, $title, $rank)
- {
- $this->filename = $file;
- $this->pageTitle = $title;
- $this->rank = $rank;
- }
-}
-
-
-///
-/// Split the search text up into keywords
-///
-///
The keywords to parse
-///
A list containing the words for which to search
-function ParseKeywords($keywords)
-{
- $keywordList = array();
- $words = preg_split("/[^\w]+/", $keywords);
-
- foreach($words as $word)
- {
- $checkWord = strtolower($word);
- $first = substr($checkWord, 0, 1);
- if(strlen($checkWord) > 2 && !ctype_digit($first) && !in_array($checkWord, $keywordList))
- {
- array_push($keywordList, $checkWord);
- }
- }
-
- return $keywordList;
-}
-
-
-///
-/// Search for the specified keywords and return the results as a block of
-/// HTML.
-///
-///
The keywords for which to search
-///
The file list
-///
The dictionary used to find the words
-///
True to sort by title, false to sort by
-/// ranking
-///
A block of HTML representing the search results.
-function Search($keywords, $fileInfo, $wordDictionary, $sortByTitle)
-{
- $sb = "
";
- $matches = array();
- $matchingFileIndices = array();
- $rankings = array();
-
- $isFirst = true;
-
- foreach($keywords as $word)
- {
- if (!array_key_exists($word, $wordDictionary))
- {
- return "Nothing found ";
- }
- $occurrences = $wordDictionary[$word];
-
- $matches[$word] = $occurrences;
- $occurrenceIndices = array();
-
- // Get a list of the file indices for this match
- foreach($occurrences as $entry)
- array_push($occurrenceIndices, ($entry >> 16));
-
- if($isFirst)
- {
- $isFirst = false;
- foreach($occurrenceIndices as $i)
- {
- array_push($matchingFileIndices, $i);
- }
- }
- else
- {
- // After the first match, remove files that do not appear for
- // all found keywords.
- for($idx = 0; $idx < count($matchingFileIndices); $idx++)
- {
- if (!in_array($matchingFileIndices[$idx], $occurrenceIndices))
- {
- array_splice($matchingFileIndices, $idx, 1);
- $idx--;
- }
- }
- }
- }
-
- if(count($matchingFileIndices) == 0)
- {
- return "Nothing found ";
- }
-
- // Rank the files based on the number of times the words occurs
- foreach($matchingFileIndices as $index)
- {
- // Split out the title, filename, and word count
- $fileIndex = explode("\x00", $fileInfo[$index]);
-
- $title = $fileIndex[0];
- $filename = $fileIndex[1];
- $wordCount = intval($fileIndex[2]);
- $matchCount = 0;
-
- foreach($keywords as $words)
- {
- $occurrences = $matches[$word];
-
- foreach($occurrences as $entry)
- {
- if(($entry >> 16) == $index)
- $matchCount += $entry & 0xFFFF;
- }
- }
-
- $r = new Ranking($filename, $title, $matchCount * 1000 / $wordCount);
- array_push($rankings, $r);
-
- if(count($rankings) > 99)
- break;
- }
-
- // Sort by rank in descending order or by page title in ascending order
- if($sortByTitle)
- {
- usort($rankings, "cmprankbytitle");
- }
- else
- {
- usort($rankings, "cmprank");
- }
-
- // Format the file list and return the results
- foreach($rankings as $r)
- {
- $f = $r->filename;
- $t = $r->pageTitle;
- $sb .= "$t ";
- }
-
- $sb .= " Omitted $c more results";
- }
-
- return $sb;
-}
-
-function cmprank($x, $y)
-{
- return $y->rank - $x->rank;
-}
-
-function cmprankbytitle($x, $y)
-{
- return strcmp($x->pageTitle, $y->pageTitle);
-}
-
-?>
diff --git a/docs/SearchHelp.php b/docs/SearchHelp.php
deleted file mode 100644
index eaa1e117f..000000000
--- a/docs/SearchHelp.php
+++ /dev/null
@@ -1,58 +0,0 @@
-
-// Contributed to the Sandcastle Help File Builder project by Thomas Levesque
-
-include("SearchHelp.inc.php");
-
- $sortByTitle = false;
-
- // The keywords for which to search should be passed in the query string
- $searchText = $_GET["Keywords"];
-
- if(empty($searchText))
- {
- ?>
-
Nothing found
-
- return;
- }
-
- // An optional SortByTitle option can also be specified
- if($_GET["SortByTitle"] == "true")
- $sortByTitle = true;
-
- $keywords = ParseKeywords($searchText);
- $letters = array();
- $wordDictionary = array();
-
- // Load the file index
- $json = file_get_contents("fti/FTI_Files.json");
- $fileList = json_decode($json);
-
- // Load the required word index files
- foreach($keywords as $word)
- {
- $letter = substr($word, 0, 1);
-
- if(!in_array($letter, $letters))
- {
- array_push($letters, $letter);
- $ascii = ord($letter);
- $ftiFile = "fti/FTI_$ascii.json";
-
- if(file_exists($ftiFile))
- {
- $json = file_get_contents($ftiFile);
- $ftiWords = json_decode($json, true);
-
- foreach($ftiWords as $ftiWord => $val)
- {
- $wordDictionary[$ftiWord] = $val;
- }
- }
- }
- }
-
- // Perform the search and return the results as a block of HTML
- $results = Search($keywords, $fileList, $wordDictionary, $sortByTitle);
- echo $results;
-?>
\ No newline at end of file
diff --git a/docs/Web.Config b/docs/Web.Config
deleted file mode 100644
index f0f3e6cb6..000000000
--- a/docs/Web.Config
+++ /dev/null
@@ -1,34 +0,0 @@
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
diff --git a/docs/WebKI.xml b/docs/WebKI.xml
deleted file mode 100644
index 99223f8f6..000000000
--- a/docs/WebKI.xml
+++ /dev/null
@@ -1,423 +0,0 @@
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
diff --git a/docs/WebTOC.xml b/docs/WebTOC.xml
deleted file mode 100644
index 3c4bdb82f..000000000
--- a/docs/WebTOC.xml
+++ /dev/null
@@ -1,458 +0,0 @@
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
diff --git a/docs/api/System.Linq.Dynamic.Core.Config.StringLiteralParsingType.html b/docs/api/System.Linq.Dynamic.Core.Config.StringLiteralParsingType.html
new file mode 100644
index 000000000..437b3a800
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.Config.StringLiteralParsingType.html
@@ -0,0 +1,163 @@
+
+
+
+
+
+
+
+
Enum StringLiteralParsingType
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Enum StringLiteralParsingType
+
+ Defines the types of string literal parsing that can be performed.
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public enum StringLiteralParsingType : byte
+
+ Fields
+
+
+
+
+ Name
+ Description
+
+
+
+
+ Default
+ Represents the default string literal parsing type. Double quotes should be escaped using the default escape character (a ).
+To check if a Value equals a double quote, use this c# code:
+var expression = "Value == \"\\\"\"";
+
+
+
+ EscapeDoubleQuoteByTwoDoubleQuotes
+ Represents a string literal parsing type where a double quote should be escaped by an extra double quote (").
+To check if a Value equals a double quote, use this c# code:
+var expression = "Value == \"\"\"\"";
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.Config.html b/docs/api/System.Linq.Dynamic.Core.Config.html
new file mode 100644
index 000000000..95d3d1317
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.Config.html
@@ -0,0 +1,129 @@
+
+
+
+
+
+
+
+
Namespace System.Linq.Dynamic.Core.Config
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+ Namespace System.Linq.Dynamic.Core.Config
+
+
+
+
+ Enums
+
+
+ Defines the types of string literal parsing that can be performed.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.AbstractDynamicLinqCustomTypeProvider.html b/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.AbstractDynamicLinqCustomTypeProvider.html
new file mode 100644
index 000000000..3c214a79f
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.AbstractDynamicLinqCustomTypeProvider.html
@@ -0,0 +1,381 @@
+
+
+
+
+
+
+
+
Class AbstractDynamicLinqCustomTypeProvider
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class AbstractDynamicLinqCustomTypeProvider
+
+ The abstract DynamicLinqCustomTypeProvider which is used by the DefaultDynamicLinqCustomTypeProvider and can be used by a custom TypeProvider like in .NET Core.
+
+
+
+
Inheritance
+
System.Object
+
AbstractDynamicLinqCustomTypeProvider
+
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public abstract class AbstractDynamicLinqCustomTypeProvider
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ FindTypesMarkedWithDynamicLinqTypeAttribute(IEnumerable<Assembly>)
+ Finds the unique types marked with DynamicLinqTypeAttribute.
+
+
+ Declaration
+
+
protected IEnumerable<Type> FindTypesMarkedWithDynamicLinqTypeAttribute(IEnumerable<Assembly> assemblies)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Collections.Generic.IEnumerable <System.Reflection.Assembly >
+ assemblies
+ The assemblies to process.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Collections.Generic.IEnumerable <System.Type >
+ System.Collections.Generic.IEnumerable<T>
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GetAssemblyTypesWithDynamicLinqTypeAttribute(IEnumerable<Assembly>)
+
+
+ Declaration
+
+
protected Type[] GetAssemblyTypesWithDynamicLinqTypeAttribute(IEnumerable<Assembly> assemblies)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Collections.Generic.IEnumerable <System.Reflection.Assembly >
+ assemblies
+ The assemblies to process.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Type []
+ Array of System.Type
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ResolveType(IEnumerable<Assembly>, String)
+ Resolve any type which is registered in the current application domain.
+
+
+ Declaration
+
+
protected Type ResolveType(IEnumerable<Assembly> assemblies, string typeName)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Collections.Generic.IEnumerable <System.Reflection.Assembly >
+ assemblies
+ The assemblies to inspect.
+
+
+
+ System.String
+ typeName
+ The typename to resolve.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Type
+ A resolved System.Type or null when not found.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ResolveTypeBySimpleName(IEnumerable<Assembly>, String)
+ Resolve a type by the simple name which is registered in the current application domain.
+
+
+ Declaration
+
+
protected Type ResolveTypeBySimpleName(IEnumerable<Assembly> assemblies, string simpleTypeName)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Collections.Generic.IEnumerable <System.Reflection.Assembly >
+ assemblies
+ The assemblies to inspect.
+
+
+
+ System.String
+ simpleTypeName
+ The simple typename to resolve.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Type
+ A resolved System.Type or null when not found.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.DefaultDynamicLinqCustomTypeProvider.html b/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.DefaultDynamicLinqCustomTypeProvider.html
new file mode 100644
index 000000000..f9b3fa151
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.DefaultDynamicLinqCustomTypeProvider.html
@@ -0,0 +1,438 @@
+
+
+
+
+
+
+
+
Class DefaultDynamicLinqCustomTypeProvider
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class DefaultDynamicLinqCustomTypeProvider
+
+ The default implementation for DefaultDynamicLinqCustomTypeProvider .
+
Scans the current AppDomain for all types marked with DynamicLinqTypeAttribute , and adds them as custom Dynamic Link types.
+
Also provides functionality to resolve a Type in the current Application Domain.
+
This class is used as default for full .NET Framework and .NET Core App 2.x and higher.
+
+
+
+
Inheritance
+
System.Object
+
+
DefaultDynamicLinqCustomTypeProvider
+
+
+
+
Inherited Members
+
+
+
+
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public class DefaultDynamicLinqCustomTypeProvider : AbstractDynamicLinqCustomTypeProvider, IDynamicLinkCustomTypeProvider, IDynamicLinqCustomTypeProvider
+
+ Constructors
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ DefaultDynamicLinqCustomTypeProvider(Boolean)
+
+
+ Declaration
+
+
[Obsolete("Please use the DefaultDynamicLinqCustomTypeProvider(ParsingConfig config, bool cacheCustomTypes = true) constructor.")]
+public DefaultDynamicLinqCustomTypeProvider(bool cacheCustomTypes = true)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Boolean
+ cacheCustomTypes
+ Defines whether to cache the CustomTypes (including extension methods) which are found in the Application Domain. Default set to 'true'.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ DefaultDynamicLinqCustomTypeProvider(ParsingConfig, Boolean)
+
+
+ Declaration
+
+
public DefaultDynamicLinqCustomTypeProvider(ParsingConfig config, bool cacheCustomTypes = true)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ ParsingConfig
+ config
+ The parsing configuration.
+
+
+
+ System.Boolean
+ cacheCustomTypes
+ Defines whether to cache the CustomTypes (including extension methods) which are found in the Application Domain. Default set to 'true'.
+
+
+
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GetCustomTypes()
+ Returns a list of custom types that System.Linq.Dynamic.Core will understand.
+
+
+ Declaration
+
+
public virtual HashSet<Type> GetCustomTypes()
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Collections.Generic.HashSet <System.Type >
+ A System.Collections.Generic.HashSet<T> list of custom types.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GetExtensionMethods()
+ Returns a list of custom extension methods that System.Linq.Dynamic.Core will understand.
+
+
+ Declaration
+
+
public Dictionary<Type, List<MethodInfo>> GetExtensionMethods()
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Collections.Generic.Dictionary <System.Type , System.Collections.Generic.List <System.Reflection.MethodInfo >>
+ A list of custom extension methods that System.Linq.Dynamic.Core will understand.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ResolveType(String)
+ Resolve any type by fullname which is registered in the current application domain.
+
+
+ Declaration
+
+
public Type ResolveType(string typeName)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.String
+ typeName
+ The typename to resolve.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Type
+ A resolved System.Type or null when not found.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ResolveTypeBySimpleName(String)
+ Resolve any type by the simple name which is registered in the current application domain.
+
+
+ Declaration
+
+
public Type ResolveTypeBySimpleName(string simpleTypeName)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.String
+ simpleTypeName
+ The typename to resolve.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Type
+ A resolved System.Type or null when not found.
+
+
+
+
+ Implements
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.DynamicLinqTypeAttribute.html b/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.DynamicLinqTypeAttribute.html
new file mode 100644
index 000000000..b8c8c062b
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.DynamicLinqTypeAttribute.html
@@ -0,0 +1,293 @@
+
+
+
+
+
+
+
+
Class DynamicLinqTypeAttribute
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class DynamicLinqTypeAttribute
+
+ Indicates to Dynamic Linq to consider the Type as a valid dynamic linq type.
+
+
+
+
Inheritance
+
System.Object
+
System.Attribute
+
DynamicLinqTypeAttribute
+
+
+
Implements
+
System.Runtime.InteropServices._Attribute
+
+
+
Inherited Members
+
+ System.Attribute.GetCustomAttributes(System.Reflection.MemberInfo, System.Type)
+
+
+ System.Attribute.GetCustomAttributes(System.Reflection.MemberInfo, System.Type, System.Boolean)
+
+
+ System.Attribute.GetCustomAttributes(System.Reflection.MemberInfo)
+
+
+ System.Attribute.GetCustomAttributes(System.Reflection.MemberInfo, System.Boolean)
+
+
+ System.Attribute.IsDefined(System.Reflection.MemberInfo, System.Type)
+
+
+ System.Attribute.IsDefined(System.Reflection.MemberInfo, System.Type, System.Boolean)
+
+
+ System.Attribute.GetCustomAttribute(System.Reflection.MemberInfo, System.Type)
+
+
+ System.Attribute.GetCustomAttribute(System.Reflection.MemberInfo, System.Type, System.Boolean)
+
+
+ System.Attribute.GetCustomAttributes(System.Reflection.ParameterInfo)
+
+
+ System.Attribute.GetCustomAttributes(System.Reflection.ParameterInfo, System.Type)
+
+
+ System.Attribute.GetCustomAttributes(System.Reflection.ParameterInfo, System.Type, System.Boolean)
+
+
+ System.Attribute.GetCustomAttributes(System.Reflection.ParameterInfo, System.Boolean)
+
+
+ System.Attribute.IsDefined(System.Reflection.ParameterInfo, System.Type)
+
+
+ System.Attribute.IsDefined(System.Reflection.ParameterInfo, System.Type, System.Boolean)
+
+
+ System.Attribute.GetCustomAttribute(System.Reflection.ParameterInfo, System.Type)
+
+
+ System.Attribute.GetCustomAttribute(System.Reflection.ParameterInfo, System.Type, System.Boolean)
+
+
+ System.Attribute.GetCustomAttributes(System.Reflection.Module, System.Type)
+
+
+ System.Attribute.GetCustomAttributes(System.Reflection.Module)
+
+
+ System.Attribute.GetCustomAttributes(System.Reflection.Module, System.Boolean)
+
+
+ System.Attribute.GetCustomAttributes(System.Reflection.Module, System.Type, System.Boolean)
+
+
+ System.Attribute.IsDefined(System.Reflection.Module, System.Type)
+
+
+ System.Attribute.IsDefined(System.Reflection.Module, System.Type, System.Boolean)
+
+
+ System.Attribute.GetCustomAttribute(System.Reflection.Module, System.Type)
+
+
+ System.Attribute.GetCustomAttribute(System.Reflection.Module, System.Type, System.Boolean)
+
+
+ System.Attribute.GetCustomAttributes(System.Reflection.Assembly, System.Type)
+
+
+ System.Attribute.GetCustomAttributes(System.Reflection.Assembly, System.Type, System.Boolean)
+
+
+ System.Attribute.GetCustomAttributes(System.Reflection.Assembly)
+
+
+ System.Attribute.GetCustomAttributes(System.Reflection.Assembly, System.Boolean)
+
+
+ System.Attribute.IsDefined(System.Reflection.Assembly, System.Type)
+
+
+ System.Attribute.IsDefined(System.Reflection.Assembly, System.Type, System.Boolean)
+
+
+ System.Attribute.GetCustomAttribute(System.Reflection.Assembly, System.Type)
+
+
+ System.Attribute.GetCustomAttribute(System.Reflection.Assembly, System.Type, System.Boolean)
+
+
+ System.Attribute.Equals(System.Object)
+
+
+ System.Attribute.GetHashCode()
+
+
+ System.Attribute.Match(System.Object)
+
+
+ System.Attribute.IsDefaultAttribute()
+
+
+ System.Attribute.System.Runtime.InteropServices._Attribute.GetTypeInfoCount(System.UInt32)
+
+
+ System.Attribute.System.Runtime.InteropServices._Attribute.GetTypeInfo(System.UInt32, System.UInt32, System.IntPtr)
+
+
+ System.Attribute.System.Runtime.InteropServices._Attribute.GetIDsOfNames(System.Guid, System.IntPtr, System.UInt32, System.UInt32, System.IntPtr)
+
+
+ System.Attribute.System.Runtime.InteropServices._Attribute.Invoke(System.UInt32, System.Guid, System.UInt32, System.Int16, System.IntPtr, System.IntPtr, System.IntPtr, System.IntPtr)
+
+
+ System.Attribute.TypeId
+
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
[AttributeUsage(AttributeTargets.Class | AttributeTargets.Struct | AttributeTargets.Enum | AttributeTargets.Interface, AllowMultiple = false, Inherited = false)]
+public sealed class DynamicLinqTypeAttribute : Attribute, _Attribute
+
+ Implements
+
+ System.Runtime.InteropServices._Attribute
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.IDynamicLinkCustomTypeProvider.html b/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.IDynamicLinkCustomTypeProvider.html
new file mode 100644
index 000000000..b78f6b3d7
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.IDynamicLinkCustomTypeProvider.html
@@ -0,0 +1,153 @@
+
+
+
+
+
+
+
+
Interface IDynamicLinkCustomTypeProvider
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Interface IDynamicLinkCustomTypeProvider
+
+ Interface for providing functionality to find custom types for or resolve any type.
+Note that this interface will be marked obsolete in the next version. Use IDynamicLinqCustomTypeProvider instead.
+
+
+
+
Inherited Members
+
+
+
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public interface IDynamicLinkCustomTypeProvider : IDynamicLinqCustomTypeProvider
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.IDynamicLinqCustomTypeProvider.html b/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.IDynamicLinqCustomTypeProvider.html
new file mode 100644
index 000000000..88325b0f7
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.IDynamicLinqCustomTypeProvider.html
@@ -0,0 +1,303 @@
+
+
+
+
+
+
+
+
Interface IDynamicLinqCustomTypeProvider
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Interface IDynamicLinqCustomTypeProvider
+
+ Interface for providing functionality to find custom types for or resolve any type.
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public interface IDynamicLinqCustomTypeProvider
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GetCustomTypes()
+ Returns a list of custom types that System.Linq.Dynamic.Core will understand.
+
+
+ Declaration
+
+
HashSet<Type> GetCustomTypes()
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Collections.Generic.HashSet <System.Type >
+ A System.Collections.Generic.HashSet<T> list of custom types.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GetExtensionMethods()
+ Returns a list of custom extension methods that System.Linq.Dynamic.Core will understand.
+
+
+ Declaration
+
+
Dictionary<Type, List<MethodInfo>> GetExtensionMethods()
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Collections.Generic.Dictionary <System.Type , System.Collections.Generic.List <System.Reflection.MethodInfo >>
+ A list of custom extension methods that System.Linq.Dynamic.Core will understand.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ResolveType(String)
+ Resolve any type by fullname which is registered in the current application domain.
+
+
+ Declaration
+
+
Type ResolveType(string typeName)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.String
+ typeName
+ The typename to resolve.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Type
+ A resolved System.Type or null when not found.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ResolveTypeBySimpleName(String)
+ Resolve any type by the simple name which is registered in the current application domain.
+
+
+ Declaration
+
+
Type ResolveTypeBySimpleName(string simpleTypeName)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.String
+ simpleTypeName
+ The typename to resolve.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Type
+ A resolved System.Type or null when not found.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.html b/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.html
new file mode 100644
index 000000000..91ba94609
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.CustomTypeProviders.html
@@ -0,0 +1,147 @@
+
+
+
+
+
+
+
+
Namespace System.Linq.Dynamic.Core.CustomTypeProviders
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+ Namespace System.Linq.Dynamic.Core.CustomTypeProviders
+
+
+
+
+ Classes
+
+
+ The abstract DynamicLinqCustomTypeProvider which is used by the DefaultDynamicLinqCustomTypeProvider and can be used by a custom TypeProvider like in .NET Core.
+
+
+ The default implementation for DefaultDynamicLinqCustomTypeProvider .
+Scans the current AppDomain for all types marked with DynamicLinqTypeAttribute , and adds them as custom Dynamic Link types.
+Also provides functionality to resolve a Type in the current Application Domain.
+This class is used as default for full .NET Framework and .NET Core App 2.x and higher.
+
+
+ Indicates to Dynamic Linq to consider the Type as a valid dynamic linq type.
+
+ Interfaces
+
+
+ Interface for providing functionality to find custom types for or resolve any type.
+Note that this interface will be marked obsolete in the next version. Use IDynamicLinqCustomTypeProvider instead.
+
+
+ Interface for providing functionality to find custom types for or resolve any type.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.DefaultQueryableAnalyzer.html b/docs/api/System.Linq.Dynamic.Core.DefaultQueryableAnalyzer.html
new file mode 100644
index 000000000..2ac920ba5
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.DefaultQueryableAnalyzer.html
@@ -0,0 +1,236 @@
+
+
+
+
+
+
+
+
Class DefaultQueryableAnalyzer
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class DefaultQueryableAnalyzer
+
+ Default implementation.
+
+
+
+
Inheritance
+
System.Object
+
DefaultQueryableAnalyzer
+
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public class DefaultQueryableAnalyzer : IQueryableAnalyzer
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SupportsLinqToObjects(IQueryable, IQueryProvider)
+ Determines whether the specified query (and provider) supports LinqToObjects.
+
+
+ Declaration
+
+
public bool SupportsLinqToObjects(IQueryable query, IQueryProvider provider = null)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ query
+ The query to check.
+
+
+
+ System.Linq.IQueryProvider
+ provider
+ The provider to check (can be null).
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+ true/false
+
+
+
+
+ Implements
+
+ See Also
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.DynamicClass.html b/docs/api/System.Linq.Dynamic.Core.DynamicClass.html
new file mode 100644
index 000000000..bc4daa81c
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.DynamicClass.html
@@ -0,0 +1,380 @@
+
+
+
+
+
+
+
+
Class DynamicClass
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class DynamicClass
+
+ Provides a base class for dynamic objects for Net 3.5
+
+
+
+
Inheritance
+
System.Object
+
DynamicClass
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public abstract class DynamicClass
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GetDynamicPropertyValue(String)
+ Gets the dynamic property value by name.
+
+
+ Declaration
+
+
public object GetDynamicPropertyValue(string propertyName)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.String
+ propertyName
+ Name of the property.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ value
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GetDynamicPropertyValue<T>(String)
+ Gets the dynamic property by name.
+
+
+ Declaration
+
+
public T GetDynamicPropertyValue<T>(string propertyName)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.String
+ propertyName
+ Name of the property.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ T
+ T
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ T
+ The type.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SetDynamicPropertyValue(String, Object)
+ Sets the dynamic property value by name.
+
+
+ Declaration
+
+
public void SetDynamicPropertyValue(string propertyName, object value)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.String
+ propertyName
+ Name of the property.
+
+
+
+ System.Object
+ value
+ The value.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SetDynamicPropertyValue<T>(String, T)
+ Sets the dynamic property value by name.
+
+
+ Declaration
+
+
public void SetDynamicPropertyValue<T>(string propertyName, T value)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.String
+ propertyName
+ Name of the property.
+
+
+
+ T
+ value
+ The value.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ T
+ The type.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.DynamicClassFactory.html b/docs/api/System.Linq.Dynamic.Core.DynamicClassFactory.html
new file mode 100644
index 000000000..33fbaf8d0
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.DynamicClassFactory.html
@@ -0,0 +1,290 @@
+
+
+
+
+
+
+
+
Class DynamicClassFactory
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class DynamicClassFactory
+
+
+
+
+
Inheritance
+
System.Object
+
DynamicClassFactory
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public static class DynamicClassFactory
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ CreateGenericComparerType(Type, Type)
+ Create a GenericComparerType based on the GenericType and an instance of a System.Collections.IComparer .
+
+
+ Declaration
+
+
public static Type CreateGenericComparerType(Type comparerGenericType, Type comparerType)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Type
+ comparerGenericType
+ The GenericType
+
+
+
+ System.Type
+ comparerType
+ The System.Collections.IComparer instance
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Type
+ Type
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ CreateType(IList<DynamicProperty>, Boolean)
+ The CreateType method creates a new data class with a given set of public properties and returns the System.Type object for the newly created class. If a data class with an identical sequence of properties has already been created, the System.Type object for this class is returned.
+Data classes implement private instance variables and read/write property accessors for the specified properties.Data classes also override the Equals and GetHashCode members to implement by-value equality.
+Data classes are created in an in-memory assembly in the current application domain. All data classes inherit from DynamicClass and are given automatically generated names that should be considered private (the names will be unique within the application domain but not across multiple invocations of the application). Note that once created, a data class stays in memory for the lifetime of the current application domain. There is currently no way to unload a dynamically created data class.
+The dynamic expression parser uses the CreateClass methods to generate classes from data object initializers. This feature in turn is often used with the dynamic Select method to create projections.
+
+
+ Declaration
+
+
public static Type CreateType(IList<DynamicProperty> properties, bool createParameterCtor = true)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Collections.Generic.IList <DynamicProperty >
+ properties
+ The DynamicProperties
+
+
+
+ System.Boolean
+ createParameterCtor
+ Create a constructor with parameters. Default set to true. Note that for Linq-to-Database objects, this needs to be set to false.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Type
+ Type
+
+
+
+
+ Examples
+ DynamicProperty[] props = new DynamicProperty[] { new DynamicProperty("Name", typeof(string)), new DynamicProperty("Birthday", typeof(DateTime)) };
+Type type = DynamicClassFactory.CreateType(props);
+DynamicClass dynamicClass = (DynamicClass) Activator.CreateInstance(type)!;
+dynamicClass.SetDynamicPropertyValue("Name", "Albert");
+dynamicClass.SetDynamicPropertyValue("Birthday", new DateTime(1879, 3, 14));
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.DynamicEnumerableExtensions.html b/docs/api/System.Linq.Dynamic.Core.DynamicEnumerableExtensions.html
new file mode 100644
index 000000000..2e393d6e8
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.DynamicEnumerableExtensions.html
@@ -0,0 +1,512 @@
+
+
+
+
+
+
+
+
Class DynamicEnumerableExtensions
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class DynamicEnumerableExtensions
+
+ Define extensions on System.Collections.IEnumerable .
+
+
+
+
Inheritance
+
System.Object
+
DynamicEnumerableExtensions
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public static class DynamicEnumerableExtensions
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ToDynamicArray(IEnumerable)
+ Creates an array of dynamic objects from a System.Collections.IEnumerable .
+
+
+ Declaration
+
+
public static object[] ToDynamicArray(this IEnumerable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Collections.IEnumerable
+ source
+ A System.Collections.IEnumerable to create an array from.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object []
+ An array that contains the elements from the input sequence.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ToDynamicArray(IEnumerable, Type)
+ Creates an array of dynamic objects from a System.Collections.IEnumerable .
+
+
+ Declaration
+
+
public static object[] ToDynamicArray(this IEnumerable source, Type type)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Collections.IEnumerable
+ source
+ A System.Collections.IEnumerable to create an array from.
+
+
+
+ System.Type
+ type
+ A System.Type cast to.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object []
+ An Array that contains the elements from the input sequence.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ToDynamicArray<T>(IEnumerable)
+ Creates an array of dynamic objects from a System.Collections.IEnumerable .
+
+
+ Declaration
+
+
public static T[] ToDynamicArray<T>(this IEnumerable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Collections.IEnumerable
+ source
+ A System.Collections.IEnumerable to create an array from.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ T[]
+ An Array{T} that contains the elements from the input sequence.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ T
+ The generic type.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ToDynamicList(IEnumerable)
+ Creates a list of dynamic objects from a System.Collections.IEnumerable .
+
+
+ Declaration
+
+
public static List<object> ToDynamicList(this IEnumerable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Collections.IEnumerable
+ source
+ A System.Collections.IEnumerable to create an array from.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Collections.Generic.List <System.Object >
+ A List that contains the elements from the input sequence.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ToDynamicList(IEnumerable, Type)
+ Creates a list of dynamic objects from a System.Collections.IEnumerable .
+
+
+ Declaration
+
+
public static List<object> ToDynamicList(this IEnumerable source, Type type)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Collections.IEnumerable
+ source
+ A System.Collections.IEnumerable to create an array from.
+
+
+
+ System.Type
+ type
+ A System.Type cast to.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Collections.Generic.List <System.Object >
+ A List that contains the elements from the input sequence.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ToDynamicList<T>(IEnumerable)
+ Creates a list of dynamic objects from a System.Collections.IEnumerable .
+
+
+ Declaration
+
+
public static List<T> ToDynamicList<T>(this IEnumerable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Collections.IEnumerable
+ source
+ A System.Collections.IEnumerable to create an array from.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Collections.Generic.List <T>
+ A List{T} that contains the elements from the input sequence.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ T
+ Generic Type
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.DynamicExpressionParser.html b/docs/api/System.Linq.Dynamic.Core.DynamicExpressionParser.html
new file mode 100644
index 000000000..799d05f3d
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.DynamicExpressionParser.html
@@ -0,0 +1,2092 @@
+
+
+
+
+
+
+
+
Class DynamicExpressionParser
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class DynamicExpressionParser
+
+ Helper class to convert an expression into an LambdaExpression
+
+
+
+
Inheritance
+
System.Object
+
DynamicExpressionParser
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public static class DynamicExpressionParser
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(Boolean, ParameterExpression[], Type, String, Object[])
+ Parses an expression into a LambdaExpression.
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(bool createParameterCtor, ParameterExpression[] parameters, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Boolean
+ createParameterCtor
+ if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.
+
+
+
+ System.Linq.Expressions.ParameterExpression []
+ parameters
+ A array from ParameterExpressions.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(Boolean, Type, Type, String, Object[])
+ Parses an expression into a LambdaExpression.
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(bool createParameterCtor, Type itType, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Boolean
+ createParameterCtor
+ if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.
+
+
+
+ System.Type
+ itType
+ The main type from the dynamic class expression.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(ParsingConfig, Boolean, ParameterExpression[], Type, String, Object[])
+ Parses an expression into a LambdaExpression.
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(ParsingConfig parsingConfig, bool createParameterCtor, ParameterExpression[] parameters, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Boolean
+ createParameterCtor
+ if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.
+
+
+
+ System.Linq.Expressions.ParameterExpression []
+ parameters
+ A array from ParameterExpressions.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(ParsingConfig, Boolean, Type, String, Object[])
+ Parses an expression into a LambdaExpression.
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(ParsingConfig parsingConfig, bool createParameterCtor, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Boolean
+ createParameterCtor
+ if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(ParsingConfig, Boolean, Type, Type, String, Object[])
+ Parses an expression into a LambdaExpression.
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(ParsingConfig parsingConfig, bool createParameterCtor, Type itType, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Boolean
+ createParameterCtor
+ if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.
+
+
+
+ System.Type
+ itType
+ The main type from the dynamic class expression.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(ParsingConfig, ParameterExpression[], Type, String, Object[])
+ Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(ParsingConfig parsingConfig, ParameterExpression[] parameters, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Linq.Expressions.ParameterExpression []
+ parameters
+ A array from ParameterExpressions.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(ParsingConfig, Type, String, Object[])
+ Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(ParsingConfig parsingConfig, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(ParsingConfig, Type, Type, String, Object[])
+ Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(ParsingConfig parsingConfig, Type itType, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Type
+ itType
+ The main type from the dynamic class expression.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(ParameterExpression[], Type, String, Object[])
+ Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(ParameterExpression[] parameters, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.Expressions.ParameterExpression []
+ parameters
+ A array from ParameterExpressions.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(Type, ParsingConfig, Boolean, ParameterExpression[], Type, String, Object[])
+ Parses an expression into a LambdaExpression.
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(Type delegateType, ParsingConfig parsingConfig, bool createParameterCtor, ParameterExpression[] parameters, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Type
+ delegateType
+ The delegate type.
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Boolean
+ createParameterCtor
+ if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.
+
+
+
+ System.Linq.Expressions.ParameterExpression []
+ parameters
+ A array from ParameterExpressions.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(Type, ParsingConfig, Boolean, Type, String, Object[])
+ Parses an expression into a LambdaExpression.
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(Type delegateType, ParsingConfig parsingConfig, bool createParameterCtor, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Type
+ delegateType
+ The delegate type.
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Boolean
+ createParameterCtor
+ if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(Type, ParsingConfig, Boolean, Type, Type, String, Object[])
+ Parses an expression into a LambdaExpression.
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(Type delegateType, ParsingConfig parsingConfig, bool createParameterCtor, Type itType, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Type
+ delegateType
+ The delegate type.
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Boolean
+ createParameterCtor
+ if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.
+
+
+
+ System.Type
+ itType
+ The main type from the dynamic class expression.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(Type, ParsingConfig, ParameterExpression[], Type, String, Object[])
+ Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(Type delegateType, ParsingConfig parsingConfig, ParameterExpression[] parameters, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Type
+ delegateType
+ The delegate type.
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Linq.Expressions.ParameterExpression []
+ parameters
+ A array from ParameterExpressions.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(Type, ParsingConfig, Type, String, Object[])
+ Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(Type delegateType, ParsingConfig parsingConfig, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Type
+ delegateType
+ The delegate type.
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(Type, ParsingConfig, Type, Type, String, Object[])
+ Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(Type delegateType, ParsingConfig parsingConfig, Type itType, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Type
+ delegateType
+ The delegate type.
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Type
+ itType
+ The main type from the dynamic class expression.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(Type, ParameterExpression[], Type, String, Object[])
+ Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(Type delegateType, ParameterExpression[] parameters, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Type
+ delegateType
+ The delegate type.
+
+
+
+ System.Linq.Expressions.ParameterExpression []
+ parameters
+ A array from ParameterExpressions.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(Type, String, Object[])
+ Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda(Type, Type, String, Object[])
+ Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
+
+
+ Declaration
+
+
[PublicAPI]
+public static LambdaExpression ParseLambda(Type itType, Type resultType, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Type
+ itType
+ The main type from the dynamic class expression.
+
+
+
+ System.Type
+ resultType
+ Type of the result. If not specified, it will be generated dynamically.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ The generated System.Linq.Expressions.LambdaExpression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda<TResult>(ParsingConfig, Boolean, ParameterExpression[], String, Object[])
+ Parses an expression into a Typed Expression.
+
+
+ Declaration
+
+
[PublicAPI]
+public static Expression<Func<TResult>> ParseLambda<TResult>(ParsingConfig parsingConfig, bool createParameterCtor, ParameterExpression[] parameters, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Boolean
+ createParameterCtor
+ if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.
+
+
+
+ System.Linq.Expressions.ParameterExpression []
+ parameters
+ A array from ParameterExpressions.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.Expression <System.Func <TResult>>
+ The generated System.Linq.Expressions.Expression
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TResult
+ The type of the result.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda<TResult>(ParsingConfig, Boolean, String, Object[])
+ Parses an expression into a Typed Expression.
+
+
+ Declaration
+
+
[PublicAPI]
+public static Expression<Func<TResult>> ParseLambda<TResult>(ParsingConfig parsingConfig, bool createParameterCtor, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Boolean
+ createParameterCtor
+ if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.Expression <System.Func <TResult>>
+ The generated System.Linq.Expressions.Expression
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TResult
+ The type of the result.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda<TResult>(Type, ParsingConfig, Boolean, ParameterExpression[], String, Object[])
+ Parses an expression into a Typed Expression.
+
+
+ Declaration
+
+
[PublicAPI]
+public static Expression<Func<TResult>> ParseLambda<TResult>(Type delegateType, ParsingConfig parsingConfig, bool createParameterCtor, ParameterExpression[] parameters, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Type
+ delegateType
+ The delegate type.
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Boolean
+ createParameterCtor
+ if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.
+
+
+
+ System.Linq.Expressions.ParameterExpression []
+ parameters
+ A array from ParameterExpressions.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.Expression <System.Func <TResult>>
+ The generated System.Linq.Expressions.Expression
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TResult
+ The type of the result.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda<TResult>(Type, ParsingConfig, Boolean, String, Object[])
+ Parses an expression into a Typed Expression.
+
+
+ Declaration
+
+
[PublicAPI]
+public static Expression<Func<TResult>> ParseLambda<TResult>(Type delegateType, ParsingConfig parsingConfig, bool createParameterCtor, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Type
+ delegateType
+ The delegate type.
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Boolean
+ createParameterCtor
+ if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.Expression <System.Func <TResult>>
+ The generated System.Linq.Expressions.Expression
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TResult
+ The type of the result.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda<T, TResult>(ParsingConfig, Boolean, String, Object[])
+ Parses an expression into a Typed Expression.
+
+
+ Declaration
+
+
[PublicAPI]
+public static Expression<Func<T, TResult>> ParseLambda<T, TResult>(ParsingConfig parsingConfig, bool createParameterCtor, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Boolean
+ createParameterCtor
+ if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.Expression <System.Func <T, TResult>>
+ The generated System.Linq.Expressions.Expression
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ T
+ The it-Type.
+
+
+
+ TResult
+ The type of the result.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseLambda<T, TResult>(Type, ParsingConfig, Boolean, String, Object[])
+ Parses an expression into a Typed Expression.
+
+
+ Declaration
+
+
[PublicAPI]
+public static Expression<Func<T, TResult>> ParseLambda<T, TResult>(Type delegateType, ParsingConfig parsingConfig, bool createParameterCtor, string expression, params object[] values)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Type
+ delegateType
+ The delegate type.
+
+
+
+ ParsingConfig
+ parsingConfig
+ The Configuration for the parsing.
+
+
+
+ System.Boolean
+ createParameterCtor
+ if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ An object array that contains zero or more objects which are used as replacement values.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.Expression <System.Func <T, TResult>>
+ The generated System.Linq.Expressions.Expression
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ T
+ The it-Type.
+
+
+
+ TResult
+ The type of the result.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.DynamicProperty.html b/docs/api/System.Linq.Dynamic.Core.DynamicProperty.html
new file mode 100644
index 000000000..2f661ea28
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.DynamicProperty.html
@@ -0,0 +1,274 @@
+
+
+
+
+
+
+
+
Class DynamicProperty
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class DynamicProperty
+
+
+
+
+
Inheritance
+
System.Object
+
DynamicProperty
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public class DynamicProperty
+
+ Constructors
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ DynamicProperty(String, Type)
+
+
+ Declaration
+
+
public DynamicProperty(string name, Type type)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.String
+ name
+ The name from the property.
+
+
+
+ System.Type
+ type
+ The type from the property.
+
+
+
+
+ Properties
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Name
+ Gets the name from the property.
+
+
+ Declaration
+
+
public string Name { get; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.String
+ The name from the property.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Type
+ Gets the type from the property.
+
+
+ Declaration
+
+
public Type Type { get; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Type
+ The type from the property.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.DynamicQueryableExtensions.html b/docs/api/System.Linq.Dynamic.Core.DynamicQueryableExtensions.html
new file mode 100644
index 000000000..a4bbcc8b5
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.DynamicQueryableExtensions.html
@@ -0,0 +1,9216 @@
+
+
+
+
+
+
+
+
Class DynamicQueryableExtensions
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class DynamicQueryableExtensions
+
+ Provides a set of static (Shared in Visual Basic) methods for querying data structures that implement System.Linq.IQueryable .
+It allows dynamic string based querying. Very handy when, at compile time, you don't know the type of queries that will be generated,
+or when downstream components only return column names to sort and filter by.
+
+
+
+
Inheritance
+
System.Object
+
DynamicQueryableExtensions
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public static class DynamicQueryableExtensions
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Aggregate(IQueryable, String, String)
+ Dynamically runs an aggregate function on the IQueryable.
+
+
+ Declaration
+
+
public static object Aggregate(this IQueryable source, string function, string member)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The IQueryable data source.
+
+
+
+ System.String
+ function
+ The name of the function to run. Can be Sum, Average, Min or Max.
+
+
+
+ System.String
+ member
+ The name of the property to aggregate over.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The value of the aggregate function run over the specified property.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ All(IQueryable, ParsingConfig, String, Object[])
+ Determines whether all the elements of a sequence satisfy a condition.
+
+
+ Declaration
+
+
[PublicAPI]
+public static bool All(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence whose elements to test for a condition.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+ true if every element of the source sequence passes the test in the specified predicate, or if the sequence is empty; otherwise, false.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ All(IQueryable, String, Object[])
+ Determines whether all the elements of a sequence satisfy a condition.
+
+
+ Declaration
+
+
[PublicAPI]
+public static bool All(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence whose elements to test for a condition.
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+ true if every element of the source sequence passes the test in the specified predicate, or if the sequence is empty; otherwise, false.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Any(IQueryable)
+ Determines whether a sequence contains any elements.
+
+
+ Declaration
+
+
public static bool Any(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence to check for being empty.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+ true if the source sequence contains any elements; otherwise, false.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result = queryable.Any();
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Any(IQueryable, ParsingConfig, String, Object[])
+ Determines whether a sequence contains any elements.
+
+
+ Declaration
+
+
[PublicAPI]
+public static bool Any(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence to check for being empty.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+ true if the source sequence contains any elements; otherwise, false.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result1 = queryable.Any("Income > 50");
+var result2 = queryable.Any("Income > @0", 50);
+var result3 = queryable.Select("Roles.Any()");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Any(IQueryable, LambdaExpression)
+ Determines whether a sequence contains any elements.
+
+
+ Declaration
+
+
public static bool Any(this IQueryable source, LambdaExpression lambda)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence to check for being empty.
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ lambda
+ A cached Lambda Expression.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+ true if the source sequence contains any elements; otherwise, false.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Any(IQueryable, String, Object[])
+ Determines whether a sequence contains any elements.
+
+
+ Declaration
+
+
public static bool Any(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+ true if the source sequence contains any elements; otherwise, false.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ AsDynamicEnumerable(IQueryable)
+ Returns the input typed as System.Collections.Generic.IEnumerable<T> of System.Object ./>
+
+
+ Declaration
+
+
public static IEnumerable<object> AsDynamicEnumerable(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The sequence to type as System.Collections.Generic.IEnumerable<T> of System.Object .
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Collections.Generic.IEnumerable <System.Object >
+ The input typed as System.Collections.Generic.IEnumerable<T> of System.Object .
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Average(IQueryable)
+ Computes the average of a sequence of numeric values.
+
+
+ Declaration
+
+
[PublicAPI]
+public static double Average(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of numeric values to calculate the average of.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Double
+ The average of the values in the sequence.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result1 = queryable.Average();
+var result2 = queryable.Select("Roles.Average()");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Average(IQueryable, ParsingConfig, String, Object[])
+ Computes the average of a sequence of numeric values.
+
+
+ Declaration
+
+
[PublicAPI]
+public static double Average(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of numeric values to calculate the average of.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Double
+ The average of the values in the sequence.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result = queryable.Average("Income");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Average(IQueryable, LambdaExpression)
+ Computes the average of a sequence of numeric values.
+
+
+ Declaration
+
+
[PublicAPI]
+public static double Average(this IQueryable source, LambdaExpression lambda)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of numeric values to calculate the average of.
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ lambda
+ A Lambda Expression.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Double
+ The average of the values in the sequence.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Average(IQueryable, String, Object[])
+ Computes the average of a sequence of numeric values.
+
+
+ Declaration
+
+
[PublicAPI]
+public static double Average(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Double
+ The average of the values in the sequence.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Cast(IQueryable, ParsingConfig, String)
+ Converts the elements of an System.Linq.IQueryable to the specified type.
+
+
+ Declaration
+
+
public static IQueryable Cast(this IQueryable source, ParsingConfig config, string typeName)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable that contains the elements to be converted.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ typeName
+ The type to convert the elements of source to.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable that contains each element of the source sequence converted to the specified type.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Cast(IQueryable, String)
+ Converts the elements of an System.Linq.IQueryable to the specified type.
+
+
+ Declaration
+
+
public static IQueryable Cast(this IQueryable source, string typeName)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable that contains the elements to be converted.
+
+
+
+ System.String
+ typeName
+ The type to convert the elements of source to.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable that contains each element of the source sequence converted to the specified type.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Cast(IQueryable, Type)
+ Converts the elements of an System.Linq.IQueryable to the specified type.
+
+
+ Declaration
+
+
public static IQueryable Cast(this IQueryable source, Type type)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable that contains the elements to be converted.
+
+
+
+ System.Type
+ type
+ The type to convert the elements of source to.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable that contains each element of the source sequence converted to the specified type.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Count(IQueryable)
+ Returns the number of elements in a sequence.
+
+
+ Declaration
+
+
public static int Count(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable that contains the elements to be counted.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Int32
+ The number of elements in the input sequence.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result = queryable.Count();
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Count(IQueryable, ParsingConfig, String, Object[])
+ Returns the number of elements in a sequence.
+
+
+ Declaration
+
+
[PublicAPI]
+public static int Count(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable that contains the elements to be counted.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Int32
+ The number of elements in the specified sequence that satisfies a condition.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result1 = queryable.Count("Income > 50");
+var result2 = queryable.Count("Income > @0", 50);
+var result3 = queryable.Select("Roles.Count()");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Count(IQueryable, LambdaExpression)
+ Returns the number of elements in a sequence.
+
+
+ Declaration
+
+
public static int Count(this IQueryable source, LambdaExpression lambda)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable that contains the elements to be counted.
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ lambda
+ A cached Lambda Expression.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Int32
+ The number of elements in the specified sequence that satisfies a condition.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Count(IQueryable, String, Object[])
+ Returns the number of elements in a sequence.
+
+
+ Declaration
+
+
public static int Count(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Int32
+ The number of elements in the specified sequence that satisfies a condition.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ DefaultIfEmpty(IQueryable)
+ Returns the elements of the specified sequence or the type parameter's default value in a singleton collection if the sequence is empty.
+
+
+ Declaration
+
+
public static IQueryable DefaultIfEmpty(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return a default value for if empty.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable that contains default if source is empty; otherwise, source.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.DefaultIfEmpty();
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ DefaultIfEmpty(IQueryable, Object)
+ Returns the elements of the specified sequence or the type parameter's default value in a singleton collection if the sequence is empty.
+
+
+ Declaration
+
+
public static IQueryable DefaultIfEmpty(this IQueryable source, object defaultValue)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return a default value for if empty.
+
+
+
+ System.Object
+ defaultValue
+ The value to return if the sequence is empty.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable that contains defaultValue if source is empty; otherwise, source.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.DefaultIfEmpty(new Employee());
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Distinct(IQueryable)
+ Returns distinct elements from a sequence by using the default equality comparer to compare values.
+
+
+ Declaration
+
+
public static IQueryable Distinct(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The sequence to remove duplicate elements from.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable that contains distinct elements from the source sequence.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result1 = queryable.Distinct();
+var result2 = queryable.Select("Roles.Distinct()");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ First(IQueryable)
+ Returns the first element of a sequence.
+
+
+ Declaration
+
+
public static object First(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return the first element of.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The first element in source.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ First(IQueryable, ParsingConfig, String, Object[])
+ Returns the first element of a sequence that satisfies a specified condition.
+
+
+ Declaration
+
+
[PublicAPI]
+public static object First(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return the first element of.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The first element in source that passes the test in predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ First(IQueryable, LambdaExpression)
+ Returns the first element of a sequence that satisfies a specified condition.
+
+
+ Declaration
+
+
public static object First(this IQueryable source, LambdaExpression lambda)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return the first element of.
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ lambda
+ A cached Lambda Expression.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The first element in source that passes the test in predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ First(IQueryable, String, Object[])
+ Returns the first element of a sequence that satisfies a specified condition.
+
+
+ Declaration
+
+
public static object First(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The first element in source that passes the test in predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ FirstOrDefault(IQueryable)
+ Returns the first element of a sequence, or a default value if the sequence contains no elements.
+
+
+ Declaration
+
+
public static object FirstOrDefault(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return the first element of.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ default if source is empty; otherwise, the first element in source.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ FirstOrDefault(IQueryable, ParsingConfig, String, Object[])
+ Returns the first element of a sequence that satisfies a specified condition or a default value if no such element is found.
+
+
+ Declaration
+
+
[PublicAPI]
+public static object FirstOrDefault(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return the first element of.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ default if source is empty or if no element passes the test specified by predicate; otherwise, the first element in source that passes the test specified by predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ FirstOrDefault(IQueryable, LambdaExpression)
+ Returns the first element of a sequence that satisfies a specified condition or a default value if no such element is found.
+
+
+ Declaration
+
+
public static object FirstOrDefault(this IQueryable source, LambdaExpression lambda)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return the first element of.
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ lambda
+ A cached Lambda Expression.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ default if source is empty or if no element passes the test specified by predicate; otherwise, the first element in source that passes the test specified by predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ FirstOrDefault(IQueryable, String, Object[])
+ Returns the first element of a sequence that satisfies a specified condition or a default value if no such element is found.
+
+
+ Declaration
+
+
public static object FirstOrDefault(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ default if source is empty or if no element passes the test specified by predicate; otherwise, the first element in source that passes the test specified by predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupBy(IQueryable, ParsingConfig, String, IEqualityComparer, Object[])
+ Groups the elements of a sequence according to a specified key string function
+and creates a result value from each group and its key.
+
+
+ Declaration
+
+
public static IQueryable GroupBy(this IQueryable source, ParsingConfig config, string keySelector, IEqualityComparer equalityComparer, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A System.Linq.IQueryable whose elements to group.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ keySelector
+ A string expression to specify the key for each element.
+
+
+
+ System.Collections.IEqualityComparer
+ equalityComparer
+ The comparer to use.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable where each element represents a projection over a group and its key.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupBy(IQueryable, ParsingConfig, String, Object[])
+ Groups the elements of a sequence according to a specified key string function
+and creates a result value from each group and its key.
+
+
+ Declaration
+
+
[PublicAPI]
+public static IQueryable GroupBy(this IQueryable source, ParsingConfig config, string keySelector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A System.Linq.IQueryable whose elements to group.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ keySelector
+ A string expression to specify the key for each element.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable where each element represents a projection over a group and its key.
+
+
+
+
+ Examples
+ var groupResult1 = queryable.GroupBy("NumberPropertyAsKey");
+var groupResult2 = queryable.GroupBy("new (NumberPropertyAsKey, StringPropertyAsKey)");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupBy(IQueryable, ParsingConfig, String, String)
+ Groups the elements of a sequence according to a specified key string function
+and creates a result value from each group and its key.
+
+
+ Declaration
+
+
public static IQueryable GroupBy(this IQueryable source, ParsingConfig config, string keySelector, string resultSelector)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A System.Linq.IQueryable whose elements to group.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ keySelector
+ A string expression to specify the key for each element.
+
+
+
+ System.String
+ resultSelector
+ A string expression to specify a result value from each group.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable where each element represents a projection over a group and its key.
+
+
+
+
+ Examples
+ var groupResult1 = queryable.GroupBy("NumberPropertyAsKey", "StringProperty");
+var groupResult2 = queryable.GroupBy("new (NumberPropertyAsKey, StringPropertyAsKey)", "new (StringProperty1, StringProperty2)");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupBy(IQueryable, ParsingConfig, String, String, IEqualityComparer)
+ Groups the elements of a sequence according to a specified key string function
+and creates a result value from each group and its key.
+
+
+ Declaration
+
+
public static IQueryable GroupBy(this IQueryable source, ParsingConfig config, string keySelector, string resultSelector, IEqualityComparer equalityComparer)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A System.Linq.IQueryable whose elements to group.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ keySelector
+ A string expression to specify the key for each element.
+
+
+
+ System.String
+ resultSelector
+ A string expression to specify a result value from each group.
+
+
+
+ System.Collections.IEqualityComparer
+ equalityComparer
+ The comparer to use.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable where each element represents a projection over a group and its key.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupBy(IQueryable, ParsingConfig, String, String, IEqualityComparer, Object[])
+ Groups the elements of a sequence according to a specified key string function
+and creates a result value from each group and its key.
+
+
+ Declaration
+
+
public static IQueryable GroupBy(this IQueryable source, ParsingConfig config, string keySelector, string resultSelector, IEqualityComparer equalityComparer, object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A System.Linq.IQueryable whose elements to group.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ keySelector
+ A string expression to specify the key for each element.
+
+
+
+ System.String
+ resultSelector
+ A string expression to specify a result value from each group.
+
+
+
+ System.Collections.IEqualityComparer
+ equalityComparer
+ The comparer to use.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable where each element represents a projection over a group and its key.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupBy(IQueryable, ParsingConfig, String, String, Object[])
+ Groups the elements of a sequence according to a specified key string function
+and creates a result value from each group and its key.
+
+
+ Declaration
+
+
[PublicAPI]
+public static IQueryable GroupBy(this IQueryable source, ParsingConfig config, string keySelector, string resultSelector, object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A System.Linq.IQueryable whose elements to group.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ keySelector
+ A string expression to specify the key for each element.
+
+
+
+ System.String
+ resultSelector
+ A string expression to specify a result value from each group.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable where each element represents a projection over a group and its key.
+
+
+
+
+ Examples
+ var groupResult1 = queryable.GroupBy("NumberPropertyAsKey", "StringProperty");
+var groupResult2 = queryable.GroupBy("new (NumberPropertyAsKey, StringPropertyAsKey)", "new (StringProperty1, StringProperty2)");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupBy(IQueryable, String, IEqualityComparer, Object[])
+ Groups the elements of a sequence according to a specified key string function
+and creates a result value from each group and its key.
+
+
+ Declaration
+
+
public static IQueryable GroupBy(this IQueryable source, string keySelector, IEqualityComparer equalityComparer, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ keySelector
+
+
+
+ System.Collections.IEqualityComparer
+ equalityComparer
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable where each element represents a projection over a group and its key.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupBy(IQueryable, String, Object[])
+ Groups the elements of a sequence according to a specified key string function
+and creates a result value from each group and its key.
+
+
+ Declaration
+
+
[PublicAPI]
+public static IQueryable GroupBy(this IQueryable source, string keySelector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ keySelector
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable where each element represents a projection over a group and its key.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupBy(IQueryable, String, String)
+ Groups the elements of a sequence according to a specified key string function
+and creates a result value from each group and its key.
+
+
+ Declaration
+
+
public static IQueryable GroupBy(this IQueryable source, string keySelector, string resultSelector)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ keySelector
+
+
+
+ System.String
+ resultSelector
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable where each element represents a projection over a group and its key.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupBy(IQueryable, String, String, IEqualityComparer)
+ Groups the elements of a sequence according to a specified key string function
+and creates a result value from each group and its key.
+
+
+ Declaration
+
+
public static IQueryable GroupBy(this IQueryable source, string keySelector, string resultSelector, IEqualityComparer equalityComparer)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ keySelector
+
+
+
+ System.String
+ resultSelector
+
+
+
+ System.Collections.IEqualityComparer
+ equalityComparer
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable where each element represents a projection over a group and its key.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupBy(IQueryable, String, String, IEqualityComparer, Object[])
+ Groups the elements of a sequence according to a specified key string function
+and creates a result value from each group and its key.
+
+
+ Declaration
+
+
public static IQueryable GroupBy(this IQueryable source, string keySelector, string resultSelector, IEqualityComparer equalityComparer, object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ keySelector
+
+
+
+ System.String
+ resultSelector
+
+
+
+ System.Collections.IEqualityComparer
+ equalityComparer
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable where each element represents a projection over a group and its key.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupBy(IQueryable, String, String, Object[])
+ Groups the elements of a sequence according to a specified key string function
+and creates a result value from each group and its key.
+
+
+ Declaration
+
+
[PublicAPI]
+public static IQueryable GroupBy(this IQueryable source, string keySelector, string resultSelector, object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ keySelector
+
+
+
+ System.String
+ resultSelector
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable where each element represents a projection over a group and its key.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupByMany<TElement>(IEnumerable<TElement>, Func<TElement, Object>[])
+ Groups the elements of a sequence according to multiple specified key functions
+and creates a result value from each group (and subgroups) and its key.
+
+
+ Declaration
+
+
public static IEnumerable<GroupResult> GroupByMany<TElement>(this IEnumerable<TElement> source, params Func<TElement, object>[] keySelectors)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Collections.Generic.IEnumerable <TElement>
+ source
+ A System.Collections.Generic.IEnumerable<T> whose elements to group.
+
+
+
+ System.Func <TElement, System.Object >[]
+ keySelectors
+ Lambda expressions to specify the keys for each element.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Collections.Generic.IEnumerable <GroupResult >
+ A System.Collections.Generic.IEnumerable<T> of type GroupResult where each element represents a projection over a group, its key, and its subgroups.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TElement
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupByMany<TElement>(IEnumerable<TElement>, ParsingConfig, String[])
+ Groups the elements of a sequence according to multiple specified key string functions
+and creates a result value from each group (and subgroups) and its key.
+
+
+ Declaration
+
+
public static IEnumerable<GroupResult> GroupByMany<TElement>(this IEnumerable<TElement> source, ParsingConfig config, params string[] keySelectors)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Collections.Generic.IEnumerable <TElement>
+ source
+ A System.Collections.Generic.IEnumerable<T> whose elements to group.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String []
+ keySelectors
+ System.String expressions to specify the keys for each element.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Collections.Generic.IEnumerable <GroupResult >
+ A System.Collections.Generic.IEnumerable<T> of type GroupResult where each element represents a projection over a group, its key, and its subgroups.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TElement
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupByMany<TElement>(IEnumerable<TElement>, String[])
+ Groups the elements of a sequence according to multiple specified key string functions
+and creates a result value from each group (and subgroups) and its key.
+
+
+ Declaration
+
+
public static IEnumerable<GroupResult> GroupByMany<TElement>(this IEnumerable<TElement> source, params string[] keySelectors)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Collections.Generic.IEnumerable <TElement>
+ source
+
+
+
+ System.String []
+ keySelectors
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Collections.Generic.IEnumerable <GroupResult >
+ A System.Collections.Generic.IEnumerable<T> of type GroupResult where each element represents a projection over a group, its key, and its subgroups.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TElement
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupJoin(IQueryable, IEnumerable, String, String, String, Object[])
+ Correlates the elements of two sequences based on equality of keys and groups the results. The default equality comparer is used to compare keys.
+
+
+ Declaration
+
+
public static IQueryable GroupJoin(this IQueryable outer, IEnumerable inner, string outerKeySelector, string innerKeySelector, string resultSelector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ outer
+
+
+
+ System.Collections.IEnumerable
+ inner
+
+
+
+ System.String
+ outerKeySelector
+
+
+
+ System.String
+ innerKeySelector
+
+
+
+ System.String
+ resultSelector
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable obtained by performing a grouped join on two sequences.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GroupJoin(IQueryable, ParsingConfig, IEnumerable, String, String, String, Object[])
+ Correlates the elements of two sequences based on equality of keys and groups the results. The default equality comparer is used to compare keys.
+
+
+ Declaration
+
+
public static IQueryable GroupJoin(this IQueryable outer, ParsingConfig config, IEnumerable inner, string outerKeySelector, string innerKeySelector, string resultSelector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ outer
+ The first sequence to join.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.Collections.IEnumerable
+ inner
+ The sequence to join to the first sequence.
+
+
+
+ System.String
+ outerKeySelector
+ A dynamic function to extract the join key from each element of the first sequence.
+
+
+
+ System.String
+ innerKeySelector
+ A dynamic function to extract the join key from each element of the second sequence.
+
+
+
+ System.String
+ resultSelector
+ A dynamic function to create a result element from an element from the first sequence and a collection of matching elements from the second sequence.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicates as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable obtained by performing a grouped join on two sequences.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Join(IQueryable, IEnumerable, String, String, String, Object[])
+ Correlates the elements of two sequences based on matching keys. The default equality comparer is used to compare keys.
+
+
+ Declaration
+
+
public static IQueryable Join(this IQueryable outer, IEnumerable inner, string outerKeySelector, string innerKeySelector, string resultSelector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ outer
+
+
+
+ System.Collections.IEnumerable
+ inner
+
+
+
+ System.String
+ outerKeySelector
+
+
+
+ System.String
+ innerKeySelector
+
+
+
+ System.String
+ resultSelector
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable obtained by performing an inner join on two sequences.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Join(IQueryable, ParsingConfig, IEnumerable, String, String, String, Object[])
+ Correlates the elements of two sequences based on matching keys. The default equality comparer is used to compare keys.
+
+
+ Declaration
+
+
public static IQueryable Join(this IQueryable outer, ParsingConfig config, IEnumerable inner, string outerKeySelector, string innerKeySelector, string resultSelector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ outer
+ The first sequence to join.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.Collections.IEnumerable
+ inner
+ The sequence to join to the first sequence.
+
+
+
+ System.String
+ outerKeySelector
+ A dynamic function to extract the join key from each element of the first sequence.
+
+
+
+ System.String
+ innerKeySelector
+ A dynamic function to extract the join key from each element of the second sequence.
+
+
+
+ System.String
+ resultSelector
+ A dynamic function to create a result element from two matching elements.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicates as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable obtained by performing an inner join on two sequences.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Join<TElement>(IQueryable<TElement>, IEnumerable<TElement>, String, String, String, Object[])
+ Correlates the elements of two sequences based on matching keys. The default equality comparer is used to compare keys.
+
+
+ Declaration
+
+
public static IQueryable<TElement> Join<TElement>(this IQueryable<TElement> outer, IEnumerable<TElement> inner, string outerKeySelector, string innerKeySelector, string resultSelector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable <TElement>
+ outer
+
+
+
+ System.Collections.Generic.IEnumerable <TElement>
+ inner
+
+
+
+ System.String
+ outerKeySelector
+
+
+
+ System.String
+ innerKeySelector
+
+
+
+ System.String
+ resultSelector
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable <TElement>
+ An System.Linq.IQueryable<T> that has elements of type TResult obtained by performing an inner join on two sequences.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TElement
+ The type of the elements of both sequences, and the result.
+
+
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Join<TElement>(IQueryable<TElement>, ParsingConfig, IEnumerable<TElement>, String, String, String, Object[])
+ Correlates the elements of two sequences based on matching keys. The default equality comparer is used to compare keys.
+
+
+ Declaration
+
+
public static IQueryable<TElement> Join<TElement>(this IQueryable<TElement> outer, ParsingConfig config, IEnumerable<TElement> inner, string outerKeySelector, string innerKeySelector, string resultSelector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable <TElement>
+ outer
+ The first sequence to join.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.Collections.Generic.IEnumerable <TElement>
+ inner
+ The sequence to join to the first sequence.
+
+
+
+ System.String
+ outerKeySelector
+ A dynamic function to extract the join key from each element of the first sequence.
+
+
+
+ System.String
+ innerKeySelector
+ A dynamic function to extract the join key from each element of the second sequence.
+
+
+
+ System.String
+ resultSelector
+ A dynamic function to create a result element from two matching elements.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicates as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable <TElement>
+ An System.Linq.IQueryable<T> that has elements of type TResult obtained by performing an inner join on two sequences.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TElement
+ The type of the elements of both sequences, and the result.
+
+
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Last(IQueryable)
+ Returns the last element of a sequence.
+
+
+ Declaration
+
+
public static object Last(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return the last element of.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The last element in source.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Last(IQueryable, ParsingConfig, String, Object[])
+ Returns the last element of a sequence that satisfies a specified condition.
+
+
+ Declaration
+
+
public static object Last(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return the last element of.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The first element in source that passes the test in predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Last(IQueryable, LambdaExpression)
+ Returns the last element of a sequence that satisfies a specified condition.
+
+
+ Declaration
+
+
public static object Last(this IQueryable source, LambdaExpression lambda)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return the last element of.
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ lambda
+ A cached Lambda Expression.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The first element in source that passes the test in predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Last(IQueryable, String, Object[])
+ Returns the last element of a sequence that satisfies a specified condition.
+
+
+ Declaration
+
+
public static object Last(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The first element in source that passes the test in predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ LastOrDefault(IQueryable)
+ Returns the last element of a sequence, or a default value if the sequence contains no elements.
+
+
+ Declaration
+
+
public static object LastOrDefault(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return the last element of.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ default if source is empty; otherwise, the last element in source.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ LastOrDefault(IQueryable, ParsingConfig, String, Object[])
+ Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements.
+
+
+ Declaration
+
+
public static object LastOrDefault(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return the last element of.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The first element in source that passes the test in predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ LastOrDefault(IQueryable, LambdaExpression)
+ Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements.
+
+
+ Declaration
+
+
public static object LastOrDefault(this IQueryable source, LambdaExpression lambda)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return the last element of.
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ lambda
+ A cached Lambda Expression.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The first element in source that passes the test in predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ LastOrDefault(IQueryable, String, Object[])
+ Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements.
+
+
+ Declaration
+
+
public static object LastOrDefault(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The first element in source that passes the test in predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ LongCount(IQueryable)
+ Returns the number of elements in a sequence.
+
+
+ Declaration
+
+
public static long LongCount(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable that contains the elements to be counted.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Int64
+ The number of elements in the input sequence.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result = queryable.LongCount();
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ LongCount(IQueryable, ParsingConfig, String, Object[])
+ Returns the number of elements in a sequence.
+
+
+ Declaration
+
+
[PublicAPI]
+public static long LongCount(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable that contains the elements to be counted.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Int64
+ The number of elements in the specified sequence that satisfies a condition.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result1 = queryable.LongCount("Income > 50");
+var result2 = queryable.LongCount("Income > @0", 50);
+var result3 = queryable.Select("Roles.LongCount()");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ LongCount(IQueryable, LambdaExpression)
+ Returns the number of elements in a sequence.
+
+
+ Declaration
+
+
public static long LongCount(this IQueryable source, LambdaExpression lambda)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable that contains the elements to be counted.
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ lambda
+ A cached Lambda Expression.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Int64
+ The number of elements in the specified sequence that satisfies a condition.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ LongCount(IQueryable, String, Object[])
+ Returns the number of elements in a sequence.
+
+
+ Declaration
+
+
public static long LongCount(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Int64
+ The number of elements in the specified sequence that satisfies a condition.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Max(IQueryable)
+ Computes the max element of a sequence.
+
+
+ Declaration
+
+
[PublicAPI]
+public static object Max(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to calculate find the max for.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The max element in the sequence.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result1 = queryable.Max();
+var result2 = queryable.Select("Roles.Max()");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Max(IQueryable, ParsingConfig, String, Object[])
+ Computes the max element of a sequence.
+
+
+ Declaration
+
+
[PublicAPI]
+public static object Max(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to calculate find the max for.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The max element in the sequence.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result = queryable.Max("Income");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Max(IQueryable, LambdaExpression)
+ Computes the max element of a sequence.
+
+
+ Declaration
+
+
[PublicAPI]
+public static object Max(this IQueryable source, LambdaExpression lambda)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to calculate find the max for.
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ lambda
+ A Lambda Expression.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The max element in the sequence.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Max(IQueryable, String, Object[])
+ Computes the max element of a sequence.
+
+
+ Declaration
+
+
[PublicAPI]
+public static object Max(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The max element in the sequence.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Min(IQueryable)
+ Computes the min element of a sequence.
+
+
+ Declaration
+
+
[PublicAPI]
+public static object Min(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to calculate find the min for.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The min element in the sequence.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result1 = queryable.Min();
+var result2 = queryable.Select("Roles.Min()");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Min(IQueryable, ParsingConfig, String, Object[])
+ Computes the min element of a sequence.
+
+
+ Declaration
+
+
[PublicAPI]
+public static object Min(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to calculate find the min for.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The min element in the sequence.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result = queryable.Min("Income");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Min(IQueryable, LambdaExpression)
+ Computes the min element of a sequence.
+
+
+ Declaration
+
+
[PublicAPI]
+public static object Min(this IQueryable source, LambdaExpression lambda)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to calculate find the min for.
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ lambda
+ A Lambda Expression.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The min element in the sequence.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Min(IQueryable, String, Object[])
+ Computes the min element of a sequence.
+
+
+ Declaration
+
+
[PublicAPI]
+public static object Min(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The min element in the sequence.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ OfType(IQueryable, ParsingConfig, String)
+ Filters the elements of an System.Linq.IQueryable based on a specified type.
+
+
+ Declaration
+
+
public static IQueryable OfType(this IQueryable source, ParsingConfig config, string typeName)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ An System.Linq.IQueryable whose elements to filter.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ typeName
+ The type to filter the elements of the sequence on.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A collection that contains the elements from source that have the type.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ OfType(IQueryable, String)
+ Filters the elements of an System.Linq.IQueryable based on a specified type.
+
+
+ Declaration
+
+
public static IQueryable OfType(this IQueryable source, string typeName)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ An System.Linq.IQueryable whose elements to filter.
+
+
+
+ System.String
+ typeName
+ The type to filter the elements of the sequence on.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A collection that contains the elements from source that have the type.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ OfType(IQueryable, Type)
+ Filters the elements of an System.Linq.IQueryable based on a specified type.
+
+
+ Declaration
+
+
public static IQueryable OfType(this IQueryable source, Type type)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ An System.Linq.IQueryable whose elements to filter.
+
+
+
+ System.Type
+ type
+ The type to filter the elements of the sequence on.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A collection that contains the elements from source that have the type.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ OrderBy(IQueryable, ParsingConfig, String, IComparer, Object[])
+ Sorts the elements of a sequence in ascending or descending order according to a key.
+
+
+ Declaration
+
+
public static IOrderedQueryable OrderBy(this IQueryable source, ParsingConfig config, string ordering, IComparer comparer, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to order.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ ordering
+ An expression string to indicate values to order by.
+
+
+
+ System.Collections.IComparer
+ comparer
+ The comparer to use.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable
+ A System.Linq.IQueryable whose elements are sorted according to the specified ordering.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ OrderBy(IQueryable, ParsingConfig, String, Object[])
+ Sorts the elements of a sequence in ascending or descending order according to a key.
+
+
+ Declaration
+
+
public static IOrderedQueryable OrderBy(this IQueryable source, ParsingConfig config, string ordering, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to order.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ ordering
+ An expression string to indicate values to order by.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable
+ A System.Linq.IQueryable whose elements are sorted according to the specified ordering.
+
+
+
+
+ Examples
+ var resultSingle = queryable.OrderBy("NumberProperty");
+var resultSingleDescending = queryable.OrderBy("NumberProperty DESC");
+var resultMultiple = queryable.OrderBy("NumberProperty, StringProperty DESC");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ OrderBy(IQueryable, String, IComparer, Object[])
+ Sorts the elements of a sequence in ascending or descending order according to a key.
+
+
+ Declaration
+
+
public static IOrderedQueryable OrderBy(this IQueryable source, string ordering, IComparer comparer, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ ordering
+
+
+
+ System.Collections.IComparer
+ comparer
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable
+ A System.Linq.IQueryable whose elements are sorted according to the specified ordering.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ OrderBy(IQueryable, String, Object[])
+ Sorts the elements of a sequence in ascending or descending order according to a key.
+
+
+ Declaration
+
+
public static IOrderedQueryable OrderBy(this IQueryable source, string ordering, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ ordering
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable
+ A System.Linq.IQueryable whose elements are sorted according to the specified ordering.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ OrderBy<TSource>(IQueryable<TSource>, ParsingConfig, String, IComparer, Object[])
+ Sorts the elements of a sequence in ascending or descending order according to a key.
+
+
+ Declaration
+
+
public static IOrderedQueryable<TSource> OrderBy<TSource>(this IQueryable<TSource> source, ParsingConfig config, string ordering, IComparer comparer, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable <TSource>
+ source
+ A sequence of values to order.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ ordering
+ An expression string to indicate values to order by.
+
+
+
+ System.Collections.IComparer
+ comparer
+ The comparer to use.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable <TSource>
+ A System.Linq.IQueryable<T> whose elements are sorted according to the specified ordering.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TSource
+ The type of the elements of source.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ OrderBy<TSource>(IQueryable<TSource>, ParsingConfig, String, Object[])
+ Sorts the elements of a sequence in ascending or descending order according to a key.
+
+
+ Declaration
+
+
public static IOrderedQueryable<TSource> OrderBy<TSource>(this IQueryable<TSource> source, ParsingConfig config, string ordering, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable <TSource>
+ source
+ A sequence of values to order.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ ordering
+ An expression string to indicate values to order by.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable <TSource>
+ A System.Linq.IQueryable<T> whose elements are sorted according to the specified ordering.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TSource
+ The type of the elements of source.
+
+
+
+
+ Examples
+ var resultSingle = queryable.OrderBy<User>("NumberProperty");
+var resultSingleDescending = queryable.OrderBy<User>("NumberProperty DESC");
+var resultMultiple = queryable.OrderBy<User>("NumberProperty, StringProperty");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ OrderBy<TSource>(IQueryable<TSource>, String, IComparer, Object[])
+ Sorts the elements of a sequence in ascending or descending order according to a key.
+
+
+ Declaration
+
+
public static IOrderedQueryable<TSource> OrderBy<TSource>(this IQueryable<TSource> source, string ordering, IComparer comparer, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable <TSource>
+ source
+ A sequence of values to order.
+
+
+
+ System.String
+ ordering
+ An expression string to indicate values to order by.
+
+
+
+ System.Collections.IComparer
+ comparer
+ The comparer to use.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable <TSource>
+ A System.Linq.IQueryable<T> whose elements are sorted according to the specified ordering.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TSource
+ The type of the elements of source.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ OrderBy<TSource>(IQueryable<TSource>, String, Object[])
+ Sorts the elements of a sequence in ascending or descending order according to a key.
+
+
+ Declaration
+
+
public static IOrderedQueryable<TSource> OrderBy<TSource>(this IQueryable<TSource> source, string ordering, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable <TSource>
+ source
+
+
+
+ System.String
+ ordering
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable <TSource>
+ A System.Linq.IQueryable<T> whose elements are sorted according to the specified ordering.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TSource
+ The type of the elements of source.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Page(IQueryable, Int32, Int32)
+ Returns the elements as paged.
+
+
+ Declaration
+
+
public static IQueryable Page(this IQueryable source, int page, int pageSize)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The IQueryable to return elements from.
+
+
+
+ System.Int32
+ page
+ The page to return.
+
+
+
+ System.Int32
+ pageSize
+ The number of elements per page.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable that contains the paged elements.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Page<TSource>(IQueryable<TSource>, Int32, Int32)
+ Returns the elements as paged.
+
+
+ Declaration
+
+
public static IQueryable<TSource> Page<TSource>(this IQueryable<TSource> source, int page, int pageSize)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable <TSource>
+ source
+ The IQueryable to return elements from.
+
+
+
+ System.Int32
+ page
+ The page to return.
+
+
+
+ System.Int32
+ pageSize
+ The number of elements per page.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable <TSource>
+ A System.Linq.IQueryable<T> that contains the paged elements.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TSource
+ The type of the source.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+
+ Returns the elements as paged and include the CurrentPage, PageCount, PageSize and RowCount.
+
+
+ Declaration
+
+
public static PagedResult PageResult(this IQueryable source, int page, int pageSize, int? rowCount = null)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The IQueryable to return elements from.
+
+
+
+ System.Int32
+ page
+ The page to return.
+
+
+
+ System.Int32
+ pageSize
+ The number of elements per page.
+
+
+
+ System.Nullable <System.Int32 >
+ rowCount
+ If this optional parameter has been defined, this value is used as the RowCount instead of executing a Linq Count().
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ PagedResult
+ PagedResult
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+
+ Returns the elements as paged and include the CurrentPage, PageCount, PageSize and RowCount.
+
+
+ Declaration
+
+
public static PagedResult<TSource> PageResult<TSource>(this IQueryable<TSource> source, int page, int pageSize, int? rowCount = null)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable <TSource>
+ source
+ The IQueryable to return elements from.
+
+
+
+ System.Int32
+ page
+ The page to return.
+
+
+
+ System.Int32
+ pageSize
+ The number of elements per page.
+
+
+
+ System.Nullable <System.Int32 >
+ rowCount
+ If this optional parameter has been defined, this value is used as the RowCount instead of executing a Linq Count().
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ PagedResult <TSource>
+ PagedResult{TSource}
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TSource
+ The type of the source.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Reverse(IQueryable)
+ Inverts the order of the elements in a sequence.
+
+
+ Declaration
+
+
public static IQueryable Reverse(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to reverse.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable whose elements correspond to those of the input sequence in reverse order.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Select(IQueryable, ParsingConfig, String, Object[])
+ Projects each element of a sequence into a new form.
+
+
+ Declaration
+
+
public static IQueryable Select(this IQueryable source, ParsingConfig config, string selector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to project.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ selector
+ A projection string expression to apply to each element.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable whose elements are the result of invoking a projection string on each element of source.
+
+
+
+
+ Examples
+ var singleField = queryable.Select("StringProperty");
+var dynamicObject = queryable.Select("new (StringProperty1, StringProperty2 as OtherStringPropertyName)");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Select(IQueryable, ParsingConfig, Type, String, Object[])
+
+
+ Declaration
+
+
public static IQueryable Select(this IQueryable source, ParsingConfig config, Type resultType, string selector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to project.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.Type
+ resultType
+ The result type.
+
+
+
+ System.String
+ selector
+ A projection string expression to apply to each element.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable whose elements are the result of invoking a projection string on each element of source.
+
+
+
+
+ Examples
+ var users = queryable.Select(typeof(User), "new (Username, Pwd as Password)");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Select(IQueryable, String, Object[])
+ Projects each element of a sequence into a new form.
+
+
+ Declaration
+
+
public static IQueryable Select(this IQueryable source, string selector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ selector
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable whose elements are the result of invoking a projection string on each element of source.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Select(IQueryable, Type, String, Object[])
+
+
+ Declaration
+
+
public static IQueryable Select(this IQueryable source, Type resultType, string selector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.Type
+ resultType
+
+
+
+ System.String
+ selector
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable whose elements are the result of invoking a projection string on each element of source.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Select<TResult>(IQueryable, ParsingConfig, String, Object[])
+
+
+ Declaration
+
+
public static IQueryable<TResult> Select<TResult>(this IQueryable source, ParsingConfig config, string selector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to project.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ selector
+ A projection string expression to apply to each element.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable <TResult>
+ An System.Linq.IQueryable<T> whose elements are the result of invoking a projection string on each element of source.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TResult
+ The type of the result.
+
+
+
+
+ Examples
+ var users = queryable.Select<User>("new (Username, Pwd as Password)");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Select<TResult>(IQueryable, String, Object[])
+
+
+ Declaration
+
+
public static IQueryable<TResult> Select<TResult>(this IQueryable source, string selector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ selector
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable <TResult>
+ An System.Linq.IQueryable<T> whose elements are the result of invoking a projection string on each element of source.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TResult
+ The type of the result.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SelectMany(IQueryable, ParsingConfig, String, Object[])
+ Projects each element of a sequence to an System.Linq.IQueryable and combines the resulting sequences into one sequence.
+
+
+ Declaration
+
+
public static IQueryable SelectMany(this IQueryable source, ParsingConfig config, string selector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to project.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ selector
+ A projection string expression to apply to each element.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable whose elements are the result of invoking a one-to-many projection function on each element of the input sequence.
+
+
+
+
+ Examples
+ var roles = users.SelectMany("Roles");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SelectMany(IQueryable, ParsingConfig, String, String, Object[], Object[])
+ Projects each element of a sequence to an System.Linq.IQueryable
+and invokes a result selector function on each element therein. The resulting
+values from each intermediate sequence are combined into a single, one-dimensional
+sequence and returned.
+
+
+ Declaration
+
+
public static IQueryable SelectMany(this IQueryable source, ParsingConfig config, string collectionSelector, string resultSelector, object[] collectionSelectorArgs = null, params object[] resultSelectorArgs)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to project.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ collectionSelector
+ A projection function to apply to each element of the input sequence.
+
+
+
+ System.String
+ resultSelector
+ A projection function to apply to each element of each intermediate sequence. Should only use x and y as parameter names.
+
+
+
+ System.Object []
+ collectionSelectorArgs
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+ System.Object []
+ resultSelectorArgs
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable whose elements are the result of invoking the one-to-many
+projection function collectionSelector on each element of source and then mapping
+each of those sequence elements and their corresponding source element to a result element.
+
+
+
+
+ Examples
+ // TODO
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SelectMany(IQueryable, ParsingConfig, String, String, String, String, Object[], Object[])
+ Projects each element of a sequence to an System.Linq.IQueryable
+and invokes a result selector function on each element therein. The resulting
+values from each intermediate sequence are combined into a single, one-dimensional
+sequence and returned.
+
+
+ Declaration
+
+
public static IQueryable SelectMany(this IQueryable source, ParsingConfig config, string collectionSelector, string resultSelector, string collectionParameterName, string resultParameterName, object[] collectionSelectorArgs = null, params object[] resultSelectorArgs)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to project.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ collectionSelector
+ A projection function to apply to each element of the input sequence.
+
+
+
+ System.String
+ resultSelector
+ A projection function to apply to each element of each intermediate sequence.
+
+
+
+ System.String
+ collectionParameterName
+ The name from collectionParameter to use. Default is x.
+
+
+
+ System.String
+ resultParameterName
+ The name from resultParameterName to use. Default is y.
+
+
+
+ System.Object []
+ collectionSelectorArgs
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+ System.Object []
+ resultSelectorArgs
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable whose elements are the result of invoking the one-to-many
+projection function collectionSelector on each element of source and then mapping
+each of those sequence elements and their corresponding source element to a result element.
+
+
+
+
+ Examples
+ // TODO
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SelectMany(IQueryable, ParsingConfig, Type, String, Object[])
+ Projects each element of a sequence to an System.Linq.IQueryable and combines the resulting sequences into one sequence.
+
+
+ Declaration
+
+
public static IQueryable SelectMany(this IQueryable source, ParsingConfig config, Type resultType, string selector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to project.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.Type
+ resultType
+ The result type.
+
+
+
+ System.String
+ selector
+ A projection string expression to apply to each element.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable whose elements are the result of invoking a one-to-many projection function on each element of the input sequence.
+
+
+
+
+ Examples
+ var permissions = users.SelectMany(typeof(Permission), "Roles.SelectMany(Permissions)");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SelectMany(IQueryable, String, Object[])
+ Projects each element of a sequence to an System.Linq.IQueryable and combines the resulting sequences into one sequence.
+
+
+ Declaration
+
+
public static IQueryable SelectMany(this IQueryable source, string selector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ selector
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable whose elements are the result of invoking a one-to-many projection function on each element of the input sequence.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SelectMany(IQueryable, String, String, Object[], Object[])
+ Projects each element of a sequence to an System.Linq.IQueryable
+and invokes a result selector function on each element therein. The resulting
+values from each intermediate sequence are combined into a single, one-dimensional
+sequence and returned.
+
+
+ Declaration
+
+
public static IQueryable SelectMany(this IQueryable source, string collectionSelector, string resultSelector, object[] collectionSelectorArgs = null, params object[] resultSelectorArgs)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ collectionSelector
+
+
+
+ System.String
+ resultSelector
+
+
+
+ System.Object []
+ collectionSelectorArgs
+
+
+
+ System.Object []
+ resultSelectorArgs
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable whose elements are the result of invoking the one-to-many
+projection function collectionSelector on each element of source and then mapping
+each of those sequence elements and their corresponding source element to a result element.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SelectMany(IQueryable, String, String, String, String, Object[], Object[])
+ Projects each element of a sequence to an System.Linq.IQueryable
+and invokes a result selector function on each element therein. The resulting
+values from each intermediate sequence are combined into a single, one-dimensional
+sequence and returned.
+
+
+ Declaration
+
+
public static IQueryable SelectMany(this IQueryable source, string collectionSelector, string resultSelector, string collectionParameterName, string resultParameterName, object[] collectionSelectorArgs = null, params object[] resultSelectorArgs)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ collectionSelector
+
+
+
+ System.String
+ resultSelector
+
+
+
+ System.String
+ collectionParameterName
+
+
+
+ System.String
+ resultParameterName
+
+
+
+ System.Object []
+ collectionSelectorArgs
+
+
+
+ System.Object []
+ resultSelectorArgs
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable whose elements are the result of invoking the one-to-many
+projection function collectionSelector on each element of source and then mapping
+each of those sequence elements and their corresponding source element to a result element.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SelectMany(IQueryable, Type, String, Object[])
+ Projects each element of a sequence to an System.Linq.IQueryable and combines the resulting sequences into one sequence.
+
+
+ Declaration
+
+
public static IQueryable SelectMany(this IQueryable source, Type resultType, string selector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.Type
+ resultType
+
+
+
+ System.String
+ selector
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable whose elements are the result of invoking a one-to-many projection function on each element of the input sequence.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SelectMany<TResult>(IQueryable, ParsingConfig, String, Object[])
+ Projects each element of a sequence to an System.Linq.IQueryable<T> and combines the resulting sequences into one sequence.
+
+
+ Declaration
+
+
public static IQueryable<TResult> SelectMany<TResult>(this IQueryable source, ParsingConfig config, string selector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of values to project.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ selector
+ A projection string expression to apply to each element.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable <TResult>
+ An System.Linq.IQueryable<T> whose elements are the result of invoking a one-to-many projection function on each element of the input sequence.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TResult
+ The type of the result.
+
+
+
+
+ Examples
+ var permissions = users.SelectMany<Permission>("Roles.SelectMany(Permissions)");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SelectMany<TResult>(IQueryable, String, Object[])
+ Projects each element of a sequence to an System.Linq.IQueryable<T> and combines the resulting sequences into one sequence.
+
+
+ Declaration
+
+
public static IQueryable<TResult> SelectMany<TResult>(this IQueryable source, string selector, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ selector
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable <TResult>
+ An System.Linq.IQueryable<T> whose elements are the result of invoking a one-to-many projection function on each element of the input sequence.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TResult
+ The type of the result.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Single(IQueryable)
+ Returns the only element of a sequence, and throws an exception if there
+is not exactly one element in the sequence.
+
+
+ Declaration
+
+
public static object Single(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A System.Linq.IQueryable to return the single element of.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The single element of the input sequence.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Single(IQueryable, ParsingConfig, String, Object[])
+ Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there
+is not exactly one element in the sequence.
+
+
+ Declaration
+
+
public static object Single(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return the last element of.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The first element in source that passes the test in predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Single(IQueryable, LambdaExpression)
+ Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there
+is not exactly one element in the sequence.
+
+
+ Declaration
+
+
public static object Single(this IQueryable source, LambdaExpression lambda)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return the last element of.
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ lambda
+ A cached Lambda Expression.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The first element in source that passes the test in predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Single(IQueryable, String, Object[])
+ Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there
+is not exactly one element in the sequence.
+
+
+ Declaration
+
+
public static object Single(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The first element in source that passes the test in predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SingleOrDefault(IQueryable)
+ Returns the only element of a sequence, or a default value if the sequence
+is empty; this method throws an exception if there is more than one element
+in the sequence.
+
+
+ Declaration
+
+
public static object SingleOrDefault(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A System.Linq.IQueryable to return the single element of.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The single element of the input sequence, or default if the sequence contains no elements.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SingleOrDefault(IQueryable, ParsingConfig, String, Object[])
+ Returns the only element of a sequence that satisfies a specified condition or a default value if the sequence
+is empty; and throws an exception if there is not exactly one element in the sequence.
+
+
+ Declaration
+
+
public static object SingleOrDefault(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return the last element of.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The first element in source that passes the test in predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SingleOrDefault(IQueryable, LambdaExpression)
+ Returns the only element of a sequence that satisfies a specified condition or a default value if the sequence
+is empty; and throws an exception if there is not exactly one element in the sequence.
+
+
+ Declaration
+
+
public static object SingleOrDefault(this IQueryable source, LambdaExpression lambda)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The System.Linq.IQueryable to return the last element of.
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ lambda
+ A cached Lambda Expression.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The first element in source that passes the test in predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SingleOrDefault(IQueryable, String, Object[])
+ Returns the only element of a sequence that satisfies a specified condition or a default value if the sequence
+is empty; and throws an exception if there is not exactly one element in the sequence.
+
+
+ Declaration
+
+
public static object SingleOrDefault(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The first element in source that passes the test in predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Skip(IQueryable, Int32)
+ Bypasses a specified number of elements in a sequence and then returns the remaining elements.
+
+
+ Declaration
+
+
public static IQueryable Skip(this IQueryable source, int count)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A System.Linq.IQueryable to return elements from.
+
+
+
+ System.Int32
+ count
+ The number of elements to skip before returning the remaining elements.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable that contains elements that occur after the specified index in the input sequence.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SkipWhile(IQueryable, ParsingConfig, String, Object[])
+ Bypasses elements in a sequence as long as a specified condition is true and then returns the remaining elements.
+
+
+ Declaration
+
+
public static IQueryable SkipWhile(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence to check for being empty.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable that contains elements from source starting at the first element in the linear series that does not pass the test specified by predicate.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result1 = queryable.SkipWhile("Income > 50");
+var result2 = queryable.SkipWhile("Income > @0", 50);
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SkipWhile(IQueryable, String, Object[])
+ Bypasses elements in a sequence as long as a specified condition is true and then returns the remaining elements.
+
+
+ Declaration
+
+
public static IQueryable SkipWhile(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable that contains elements from source starting at the first element in the linear series that does not pass the test specified by predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Sum(IQueryable)
+ Computes the sum of a sequence of numeric values.
+
+
+ Declaration
+
+
[PublicAPI]
+public static object Sum(this IQueryable source)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of numeric values to calculate the sum of.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The sum of the values in the sequence.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result1 = queryable.Sum();
+var result2 = queryable.Select("Roles.Sum()");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Sum(IQueryable, ParsingConfig, String, Object[])
+ Computes the sum of a sequence of numeric values.
+
+
+ Declaration
+
+
[PublicAPI]
+public static object Sum(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of numeric values to calculate the sum of.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The sum of the values in the sequence.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result = queryable.Sum("Income");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Sum(IQueryable, LambdaExpression)
+ Computes the sum of a sequence of numeric values.
+
+
+ Declaration
+
+
[PublicAPI]
+public static object Sum(this IQueryable source, LambdaExpression lambda)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence of numeric values to calculate the sum of.
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ lambda
+ A Lambda Expression.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The sum of the values in the sequence.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Sum(IQueryable, String, Object[])
+ Computes the sum of a sequence of numeric values.
+
+
+ Declaration
+
+
[PublicAPI]
+public static object Sum(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+ The sum of the values in the sequence.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Take(IQueryable, Int32)
+ Returns a specified number of contiguous elements from the start of a sequence.
+
+
+ Declaration
+
+
public static IQueryable Take(this IQueryable source, int count)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ The sequence to return elements from.
+
+
+
+ System.Int32
+ count
+ The number of elements to return.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable that contains the specified number of elements from the start of source.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ TakeWhile(IQueryable, ParsingConfig, String, Object[])
+ Returns elements from a sequence as long as a specified condition is true.
+
+
+ Declaration
+
+
public static IQueryable TakeWhile(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A sequence to check for being empty.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ A function to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable that contains elements from the input sequence occurring before the element at which the test specified by predicate no longer passes.
+
+
+
+
+ Examples
+ IQueryable queryable = employees.AsQueryable();
+var result1 = queryable.TakeWhile("Income > 50");
+var result2 = queryable.TakeWhile("Income > @0", 50);
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ TakeWhile(IQueryable, String, Object[])
+ Returns elements from a sequence as long as a specified condition is true.
+
+
+ Declaration
+
+
public static IQueryable TakeWhile(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ An System.Linq.IQueryable that contains elements from the input sequence occurring before the element at which the test specified by predicate no longer passes.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ThenBy(IOrderedQueryable, ParsingConfig, String, IComparer, Object[])
+ Performs a subsequent ordering of the elements in a sequence in ascending order according to a key.
+
+
+ Declaration
+
+
public static IOrderedQueryable ThenBy(this IOrderedQueryable source, ParsingConfig config, string ordering, IComparer comparer, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable
+ source
+ A sequence of values to order.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ ordering
+ An expression string to indicate values to order by.
+
+
+
+ System.Collections.IComparer
+ comparer
+ The comparer to use.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable
+ A System.Linq.IQueryable whose elements are sorted according to the specified ordering.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ThenBy(IOrderedQueryable, ParsingConfig, String, Object[])
+ Performs a subsequent ordering of the elements in a sequence in ascending order according to a key.
+
+
+ Declaration
+
+
public static IOrderedQueryable ThenBy(this IOrderedQueryable source, ParsingConfig config, string ordering, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable
+ source
+ A sequence of values to order.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ ordering
+ An expression string to indicate values to order by.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable
+ A System.Linq.IQueryable whose elements are sorted according to the specified ordering.
+
+
+
+
+ Examples
+ var result = queryable.OrderBy("LastName");
+var resultSingle = result.OrderBy("NumberProperty");
+var resultSingleDescending = result.OrderBy("NumberProperty DESC");
+var resultMultiple = result.OrderBy("NumberProperty, StringProperty DESC");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ThenBy(IOrderedQueryable, String, IComparer, Object[])
+ Performs a subsequent ordering of the elements in a sequence in ascending order according to a key.
+
+
+ Declaration
+
+
public static IOrderedQueryable ThenBy(this IOrderedQueryable source, string ordering, IComparer comparer, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable
+ source
+
+
+
+ System.String
+ ordering
+
+
+
+ System.Collections.IComparer
+ comparer
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable
+ A System.Linq.IQueryable whose elements are sorted according to the specified ordering.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ThenBy(IOrderedQueryable, String, Object[])
+ Performs a subsequent ordering of the elements in a sequence in ascending order according to a key.
+
+
+ Declaration
+
+
public static IOrderedQueryable ThenBy(this IOrderedQueryable source, string ordering, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable
+ source
+
+
+
+ System.String
+ ordering
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable
+ A System.Linq.IQueryable whose elements are sorted according to the specified ordering.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ThenBy<TSource>(IOrderedQueryable<TSource>, ParsingConfig, String, IComparer, Object[])
+ Performs a subsequent ordering of the elements in a sequence in ascending order according to a key.
+
+
+ Declaration
+
+
public static IOrderedQueryable<TSource> ThenBy<TSource>(this IOrderedQueryable<TSource> source, ParsingConfig config, string ordering, IComparer comparer, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable <TSource>
+ source
+ A sequence of values to order.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ ordering
+ An expression string to indicate values to order by.
+
+
+
+ System.Collections.IComparer
+ comparer
+ The comparer to use.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable <TSource>
+ A System.Linq.IOrderedQueryable<T> whose elements are sorted according to the specified ordering.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TSource
+ The type of the elements of source.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ThenBy<TSource>(IOrderedQueryable<TSource>, ParsingConfig, String, Object[])
+ Performs a subsequent ordering of the elements in a sequence in ascending order according to a key.
+
+
+ Declaration
+
+
public static IOrderedQueryable<TSource> ThenBy<TSource>(this IOrderedQueryable<TSource> source, ParsingConfig config, string ordering, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable <TSource>
+ source
+ A sequence of values to order.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ ordering
+ An expression string to indicate values to order by.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable <TSource>
+ A System.Linq.IOrderedQueryable<T> whose elements are sorted according to the specified ordering.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TSource
+ The type of the elements of source.
+
+
+
+
+ Examples
+ var result = queryable.OrderBy<User>("LastName");
+var resultSingle = result.ThenBy<User>("NumberProperty");
+var resultSingleDescending = result.ThenBy<User>("NumberProperty DESC");
+var resultMultiple = result.ThenBy<User>("NumberProperty, StringProperty");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ThenBy<TSource>(IOrderedQueryable<TSource>, String, IComparer, Object[])
+ Performs a subsequent ordering of the elements in a sequence in ascending order according to a key.
+
+
+ Declaration
+
+
public static IOrderedQueryable<TSource> ThenBy<TSource>(this IOrderedQueryable<TSource> source, string ordering, IComparer comparer, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable <TSource>
+ source
+ A sequence of values to order.
+
+
+
+ System.String
+ ordering
+ An expression string to indicate values to order by.
+
+
+
+ System.Collections.IComparer
+ comparer
+ The comparer to use.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable <TSource>
+ A System.Linq.IOrderedQueryable<T> whose elements are sorted according to the specified ordering.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TSource
+ The type of the elements of source.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ThenBy<TSource>(IOrderedQueryable<TSource>, String, Object[])
+ Performs a subsequent ordering of the elements in a sequence in ascending order according to a key.
+
+
+ Declaration
+
+
public static IOrderedQueryable<TSource> ThenBy<TSource>(this IOrderedQueryable<TSource> source, string ordering, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable <TSource>
+ source
+
+
+
+ System.String
+ ordering
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IOrderedQueryable <TSource>
+ A System.Linq.IOrderedQueryable<T> whose elements are sorted according to the specified ordering.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TSource
+ The type of the elements of source.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Where(IQueryable, ParsingConfig, String, Object[])
+ Filters a sequence of values based on a predicate.
+
+
+ Declaration
+
+
public static IQueryable Where(this IQueryable source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A System.Linq.IQueryable to filter.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ An expression string to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable that contains elements from the input sequence that satisfy the condition specified by predicate.
+
+
+
+
+ Examples
+ var result1 = queryable.Where("NumberProperty = 1");
+var result2 = queryable.Where("NumberProperty = @0", 1);
+var result3 = queryable.Where("StringProperty = null");
+var result4 = queryable.Where("StringProperty = \"abc\"");
+var result5 = queryable.Where("StringProperty = @0", "abc");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Where(IQueryable, LambdaExpression)
+ Filters a sequence of values based on a predicate.
+
+
+ Declaration
+
+
public static IQueryable Where(this IQueryable source, LambdaExpression lambda)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+ A System.Linq.IQueryable to filter.
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ lambda
+ A cached Lambda Expression.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable that contains elements from the input sequence that satisfy the condition specified by LambdaExpression.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Where(IQueryable, String, Object[])
+ Filters a sequence of values based on a predicate.
+
+
+ Declaration
+
+
public static IQueryable Where(this IQueryable source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ A System.Linq.IQueryable that contains elements from the input sequence that satisfy the condition specified by predicate.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Where<TSource>(IQueryable<TSource>, ParsingConfig, String, Object[])
+ Filters a sequence of values based on a predicate.
+
+
+ Declaration
+
+
public static IQueryable<TSource> Where<TSource>(this IQueryable<TSource> source, ParsingConfig config, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable <TSource>
+ source
+ A System.Linq.IQueryable<T> to filter.
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig .
+
+
+
+ System.String
+ predicate
+ An expression string to test each element for a condition.
+
+
+
+ System.Object []
+ args
+ An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable <TSource>
+ A System.Linq.IQueryable<T> that contains elements from the input sequence that satisfy the condition specified by predicate.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TSource
+ The type of the elements of source.
+
+
+
+
+ Examples
+ var result1 = queryable.Where("NumberProperty = 1");
+var result2 = queryable.Where("NumberProperty = @0", 1);
+var result3 = queryable.Where("StringProperty = null");
+var result4 = queryable.Where("StringProperty = \"abc\"");
+var result5 = queryable.Where("StringProperty = @0", "abc");
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Where<TSource>(IQueryable<TSource>, LambdaExpression)
+ Filters a sequence of values based on a predicate.
+
+
+ Declaration
+
+
public static IQueryable<TSource> Where<TSource>(this IQueryable<TSource> source, LambdaExpression lambda)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable <TSource>
+ source
+
+
+
+ System.Linq.Expressions.LambdaExpression
+ lambda
+ A cached Lambda Expression.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable <TSource>
+ A System.Linq.IQueryable that contains elements from the input sequence that satisfy the condition specified by LambdaExpression.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TSource
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Where<TSource>(IQueryable<TSource>, String, Object[])
+ Filters a sequence of values based on a predicate.
+
+
+ Declaration
+
+
public static IQueryable<TSource> Where<TSource>(this IQueryable<TSource> source, string predicate, params object[] args)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable <TSource>
+ source
+
+
+
+ System.String
+ predicate
+
+
+
+ System.Object []
+ args
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable <TSource>
+ A System.Linq.IQueryable<T> that contains elements from the input sequence that satisfy the condition specified by predicate.
+
+
+
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TSource
+ The type of the elements of source.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.Exceptions.ParseException.html b/docs/api/System.Linq.Dynamic.Core.Exceptions.ParseException.html
new file mode 100644
index 000000000..9b5d056c1
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.Exceptions.ParseException.html
@@ -0,0 +1,363 @@
+
+
+
+
+
+
+
+
Class ParseException
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class ParseException
+
+ Represents errors that occur while parsing dynamic linq string expressions.
+
+
+
+
Inheritance
+
System.Object
+
System.Exception
+
ParseException
+
+
+
Implements
+
System.Runtime.Serialization.ISerializable
+
System.Runtime.InteropServices._Exception
+
+
+
Inherited Members
+
+ System.Exception.GetBaseException()
+
+
+ System.Exception.GetType()
+
+
+ System.Exception.Message
+
+
+ System.Exception.Data
+
+
+ System.Exception.InnerException
+
+
+ System.Exception.TargetSite
+
+
+ System.Exception.StackTrace
+
+
+ System.Exception.HelpLink
+
+
+ System.Exception.Source
+
+
+ System.Exception.HResult
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
[Serializable]
+public sealed class ParseException : Exception, ISerializable, _Exception
+
+ Constructors
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseException(String, Int32, Exception)
+ Initializes a new instance of the ParseException class with a specified error message and position.
+
+
+ Declaration
+
+
public ParseException(string message, int position, Exception innerException = null)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.String
+ message
+ The message that describes the error.
+
+
+
+ System.Int32
+ position
+ The location in the parsed string that produced the ParseException
+
+
+
+ System.Exception
+ innerException
+ The exception that is the cause of the current exception, or a null reference if no inner exception is specified.
+
+
+
+
+ Properties
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Position
+
+
+ Declaration
+
+
public int Position { get; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Int32
+
+
+
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GetObjectData(SerializationInfo, StreamingContext)
+ When overridden in a derived class, sets the System.Runtime.Serialization.SerializationInfo with information about the exception.
+
+
+ Declaration
+
+
public override void GetObjectData(SerializationInfo info, StreamingContext context)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Runtime.Serialization.SerializationInfo
+ info
+ The System.Runtime.Serialization.SerializationInfo that holds the serialized object data about the exception being thrown.
+
+
+
+ System.Runtime.Serialization.StreamingContext
+ context
+ The System.Runtime.Serialization.StreamingContext that contains contextual information about the source or destination.
+
+
+
+
+ Overrides
+ System.Exception.GetObjectData(System.Runtime.Serialization.SerializationInfo, System.Runtime.Serialization.StreamingContext)
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ToString()
+ Creates and returns a string representation of the current exception.
+
+
+ Declaration
+
+
public override string ToString()
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.String
+ A string representation of the current exception.
+
+
+
+
+ Overrides
+ System.Exception.ToString()
+ Implements
+
+ System.Runtime.Serialization.ISerializable
+
+
+ System.Runtime.InteropServices._Exception
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.Exceptions.html b/docs/api/System.Linq.Dynamic.Core.Exceptions.html
new file mode 100644
index 000000000..41dd7b270
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.Exceptions.html
@@ -0,0 +1,129 @@
+
+
+
+
+
+
+
+
Namespace System.Linq.Dynamic.Core.Exceptions
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+ Namespace System.Linq.Dynamic.Core.Exceptions
+
+
+
+
+ Classes
+
+
+ Represents errors that occur while parsing dynamic linq string expressions.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.ExtensibilityPoint.html b/docs/api/System.Linq.Dynamic.Core.ExtensibilityPoint.html
new file mode 100644
index 000000000..24c12ff33
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.ExtensibilityPoint.html
@@ -0,0 +1,200 @@
+
+
+
+
+
+
+
+
Class ExtensibilityPoint
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class ExtensibilityPoint
+
+ Extensibility point: If you want to modify expanded queries before executing them
+set your own functionality to override empty QueryOptimizer
+
+
+
+
Inheritance
+
System.Object
+
ExtensibilityPoint
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public class ExtensibilityPoint
+
+ Fields
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+ QueryOptimizer
+ Place to optimize your queries. Example: Add a reference to Nuget package Linq.Expression.Optimizer
+and in your program initializers set Extensibility.QueryOptimizer = ExpressionOptimizer.visit;
+
+
+ Declaration
+
+
public static Func<Expression, Expression> QueryOptimizer
+
+ Field Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Func <System.Linq.Expressions.Expression , System.Linq.Expressions.Expression >
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.GroupResult.html b/docs/api/System.Linq.Dynamic.Core.GroupResult.html
new file mode 100644
index 000000000..f45e02b36
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.GroupResult.html
@@ -0,0 +1,325 @@
+
+
+
+
+
+
+
+
Class GroupResult
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class GroupResult
+
+
+
+
+
Inheritance
+
System.Object
+
GroupResult
+
+
+
Inherited Members
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public class GroupResult
+
+ Properties
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Count
+ The number of resulting elements in the group.
+
+
+ Declaration
+
+
public int Count { get; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Int32
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Items
+ The resulting elements in the group.
+
+
+ Declaration
+
+
public IEnumerable Items { get; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Collections.IEnumerable
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Key
+ The key value of the group.
+
+
+ Declaration
+
+
public object Key { get; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Subgroups
+ The resulting subgroups in the group.
+
+
+ Declaration
+
+
public IEnumerable<GroupResult> Subgroups { get; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Collections.Generic.IEnumerable <GroupResult >
+
+
+
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ToString()
+ Returns a System.String showing the key of the group and the number of items in the group.
+
+
+ Declaration
+
+
public override string ToString()
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.String
+ A System.String that represents this instance.
+
+
+
+
+ Overrides
+ System.Object.ToString()
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.IAssemblyHelper.html b/docs/api/System.Linq.Dynamic.Core.IAssemblyHelper.html
new file mode 100644
index 000000000..6671bfd97
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.IAssemblyHelper.html
@@ -0,0 +1,171 @@
+
+
+
+
+
+
+
+
Interface IAssemblyHelper
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Interface IAssemblyHelper
+
+ IAssemblyHelper interface which is used to retrieve assemblies that have been loaded into the execution context of this application domain.
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public interface IAssemblyHelper
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ GetAssemblies()
+ Gets the assemblies that have been loaded into the execution context of this application domain.
+
+
+ Declaration
+
+
Assembly[] GetAssemblies()
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Reflection.Assembly []
+ An array of assemblies in this application domain.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.IQueryableAnalyzer.html b/docs/api/System.Linq.Dynamic.Core.IQueryableAnalyzer.html
new file mode 100644
index 000000000..f1683381a
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.IQueryableAnalyzer.html
@@ -0,0 +1,195 @@
+
+
+
+
+
+
+
+
Interface IQueryableAnalyzer
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Interface IQueryableAnalyzer
+
+ Interface for QueryableAnalyzer.
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public interface IQueryableAnalyzer
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SupportsLinqToObjects(IQueryable, IQueryProvider)
+ Determines whether the specified query (and provider) supports LinqToObjects.
+
+
+ Declaration
+
+
bool SupportsLinqToObjects(IQueryable query, IQueryProvider provider = null)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ query
+ The query to check.
+
+
+
+ System.Linq.IQueryProvider
+ provider
+ The provider to check (can be null).
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+ true/false
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.PagedResult-1.html b/docs/api/System.Linq.Dynamic.Core.PagedResult-1.html
new file mode 100644
index 000000000..bae6619c5
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.PagedResult-1.html
@@ -0,0 +1,229 @@
+
+
+
+
+
+
+
+
Class PagedResult<TSource>
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class PagedResult<TSource>
+
+
+
+
+
Inheritance
+
System.Object
+
+
PagedResult<TSource>
+
+
+
Inherited Members
+
+
+
+
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public class PagedResult<TSource> : PagedResult
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ TSource
+ The type of the source.
+
+
+
+
+ Properties
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Queryable
+ Gets or sets the queryable.
+
+
+ Declaration
+
+
public IQueryable<TSource> Queryable { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable <TSource>
+ The queryable.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.PagedResult.html b/docs/api/System.Linq.Dynamic.Core.PagedResult.html
new file mode 100644
index 000000000..5beadfa5d
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.PagedResult.html
@@ -0,0 +1,329 @@
+
+
+
+
+
+
+
+
Class PagedResult
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class PagedResult
+
+
+
+
+
Inheritance
+
System.Object
+
PagedResult
+
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public class PagedResult
+
+ Properties
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ CurrentPage
+ Gets or sets the current page.
+
+
+ Declaration
+
+
public int CurrentPage { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Int32
+ The current page.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ PageCount
+ Gets or sets the page count.
+
+
+ Declaration
+
+
public int PageCount { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Int32
+ The page count.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ PageSize
+ Gets or sets the size of the page.
+
+
+ Declaration
+
+
public int PageSize { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Int32
+ The size of the page.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Queryable
+ Gets or sets the queryable.
+
+
+ Declaration
+
+
public IQueryable Queryable { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.IQueryable
+ The queryable.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ RowCount
+ Gets or sets the row count.
+
+
+ Declaration
+
+
public int RowCount { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Int32
+ The row count.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.Parser.ExpressionParser.html b/docs/api/System.Linq.Dynamic.Core.Parser.ExpressionParser.html
new file mode 100644
index 000000000..b242b36fb
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.Parser.ExpressionParser.html
@@ -0,0 +1,345 @@
+
+
+
+
+
+
+
+
Class ExpressionParser
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class ExpressionParser
+
+
+
+
+
Inheritance
+
System.Object
+
ExpressionParser
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public class ExpressionParser
+
+ Constructors
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ExpressionParser(ParameterExpression[], String, Object[], ParsingConfig)
+
+
+ Declaration
+
+
public ExpressionParser(ParameterExpression[] parameters, string expression, object[] values, ParsingConfig parsingConfig)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.Expressions.ParameterExpression []
+ parameters
+ The parameters.
+
+
+
+ System.String
+ expression
+ The expression.
+
+
+
+ System.Object []
+ values
+ The values.
+
+
+
+ ParsingConfig
+ parsingConfig
+ The parsing configuration.
+
+
+
+
+ Properties
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ItName
+ Gets name for the it field. By default this is set to the KeyWord value "it".
+
+
+ Declaration
+
+
public string ItName { get; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.String
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ LastLambdaItName
+ There was a problem when an expression contained multiple lambdas where the ItName was not cleared and freed for the next lambda.
+This variable stores the ItName of the last parsed lambda.
+Not used internally by ExpressionParser, but used to preserve compatibility of parsingConfig.RenameParameterExpression
+which was designed to only work with mono-lambda expressions.
+
+
+ Declaration
+
+
public string LastLambdaItName { get; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.String
+
+
+
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Parse(Type, Boolean)
+ Uses the TextParser to parse the string into the specified result type.
+
+
+ Declaration
+
+
public Expression Parse(Type resultType, bool createParameterCtor = true)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Type
+ resultType
+ Type of the result.
+
+
+
+ System.Boolean
+ createParameterCtor
+ if set to true [create parameter ctor].
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.Expression
+ Expression
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.Parser.ExpressionPromoter.html b/docs/api/System.Linq.Dynamic.Core.Parser.ExpressionPromoter.html
new file mode 100644
index 000000000..ce8bc710f
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.Parser.ExpressionPromoter.html
@@ -0,0 +1,280 @@
+
+
+
+
+
+
+
+
Class ExpressionPromoter
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class ExpressionPromoter
+
+
+
+
+
Inheritance
+
System.Object
+
ExpressionPromoter
+
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+
+
+
public class ExpressionPromoter : IExpressionPromoter
+
+ Constructors
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+
+
+
+ Declaration
+
+
public ExpressionPromoter(ParsingConfig config)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig.
+
+
+
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+
+
+
+ Declaration
+
+
public virtual Expression Promote(Expression expr, Type type, bool exact, bool convertExpr)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.Expressions.Expression
+ expr
+ Source expression
+
+
+
+ System.Type
+ type
+ Destination data type to promote
+
+
+
+ System.Boolean
+ exact
+ If the match must be exact
+
+
+
+ System.Boolean
+ convertExpr
+ Convert expression
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.Expression
+ The promoted System.Linq.Expressions.Expression or null.
+
+
+
+
+ Implements
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.Parser.IExpressionPromoter.html b/docs/api/System.Linq.Dynamic.Core.Parser.IExpressionPromoter.html
new file mode 100644
index 000000000..27a9709a4
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.Parser.IExpressionPromoter.html
@@ -0,0 +1,209 @@
+
+
+
+
+
+
+
+
Interface IExpressionPromoter
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Interface IExpressionPromoter
+
+ Expression promoter is used to promote object or value types
+to their destination type when an automatic promotion is available
+such as: int to int?
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+
+
+
public interface IExpressionPromoter
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+
+
+
+ Declaration
+
+
Expression Promote(Expression expr, Type type, bool exact, bool convertExpr)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Linq.Expressions.Expression
+ expr
+ Source expression
+
+
+
+ System.Type
+ type
+ Destination data type to promote
+
+
+
+ System.Boolean
+ exact
+ If the match must be exact
+
+
+
+ System.Boolean
+ convertExpr
+ Convert expression
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.Expression
+ The promoted System.Linq.Expressions.Expression or null.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.Parser.NumberParser.html b/docs/api/System.Linq.Dynamic.Core.Parser.NumberParser.html
new file mode 100644
index 000000000..35999d059
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.Parser.NumberParser.html
@@ -0,0 +1,433 @@
+
+
+
+
+
+
+
+
Class NumberParser
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class NumberParser
+
+
+
+
+
Inheritance
+
System.Object
+
NumberParser
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public class NumberParser
+
+ Constructors
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ NumberParser(ParsingConfig)
+
+
+ Declaration
+
+
public NumberParser(ParsingConfig config)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ ParsingConfig
+ config
+ The ParsingConfig.
+
+
+
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseIntegerLiteral(Int32, String)
+ Tries to parse the text into a IntegerLiteral ConstantExpression.
+
+
+ Declaration
+
+
public Expression ParseIntegerLiteral(int tokenPosition, string text)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.Int32
+ tokenPosition
+ The current token position (needed for error reporting).
+
+
+
+ System.String
+ text
+ The text.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.Expression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseNumber(String, Type)
+ Parses the number (text) into the specified type.
+
+
+ Declaration
+
+
public object ParseNumber(string text, Type type)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.String
+ text
+ The text.
+
+
+
+ System.Type
+ type
+ The type.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Object
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ParseRealLiteral(String, Char, Boolean)
+ Parse the text into a Real ConstantExpression.
+
+
+ Declaration
+
+
public Expression ParseRealLiteral(string text, char qualifier, bool stripQualifier)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.String
+ text
+
+
+
+ System.Char
+ qualifier
+
+
+
+ System.Boolean
+ stripQualifier
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Linq.Expressions.Expression
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ TryParseNumber(String, Type, out Object)
+ Tries to parse the number (text) into the specified type.
+
+
+ Declaration
+
+
public bool TryParseNumber(string text, Type type, out object result)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ System.String
+ text
+ The text.
+
+
+
+ System.Type
+ type
+ The type.
+
+
+
+ System.Object
+ result
+ The result.
+
+
+
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.Parser.html b/docs/api/System.Linq.Dynamic.Core.Parser.html
new file mode 100644
index 000000000..4d648ac15
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.Parser.html
@@ -0,0 +1,142 @@
+
+
+
+
+
+
+
+
Namespace System.Linq.Dynamic.Core.Parser
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+ Namespace System.Linq.Dynamic.Core.Parser
+
+
+
+
+ Classes
+
+
+
+
+
+
+
+ Interfaces
+
+
+ Expression promoter is used to promote object or value types
+to their destination type when an automatic promotion is available
+such as: int to int?
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.ParsingConfig.html b/docs/api/System.Linq.Dynamic.Core.ParsingConfig.html
new file mode 100644
index 000000000..a2c29bdfb
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.ParsingConfig.html
@@ -0,0 +1,1088 @@
+
+
+
+
+
+
+
+
Class ParsingConfig
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class ParsingConfig
+
+ Configuration class for System.Linq.Dynamic.Core.
+
+
+
+
Inheritance
+
System.Object
+
ParsingConfig
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public class ParsingConfig
+
+ Properties
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ AllowNewToEvaluateAnyType
+ Allows the New() keyword to evaluate any available Type.
+
Default value is false.
+
+
+ Declaration
+
+
public bool AllowNewToEvaluateAnyType { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ AreContextKeywordsEnabled
+ Determines if the context keywords (it, parent, and root) are valid and usable inside a Dynamic Linq string expression.
+Does not affect the usability of the equivalent context symbols ($, ^ and ~).
+
Default value is false.
+
+
+ Declaration
+
+
public bool AreContextKeywordsEnabled { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ConstantExpressionCacheConfig
+ Caches constant expressions to enhance performance. Periodic cleanup is performed to manage cache size, governed by this configuration.
+
+
+ Declaration
+
+
public CacheConfig ConstantExpressionCacheConfig { get; set; }
+
+ Property Value
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ConvertObjectToSupportComparison
+ Converts typeof(object) to the correct type to allow comparison (Equal, NotEqual, GreaterThan, GreaterThanEqual, LessThan and LessThanEqual).
+
Default value is false.
+
When set to true, the following code will work correct:
+
+
class Person
+{
+ public string Name { get; set; }
+ public object Age { get; set; }
+}
+
+var persons = new[]
+{
+ new Person { Name = "Foo", Age = 99 },
+ new Person { Name = "Bar", Age = 33 }
+}.AsQueryable();
+
+var config = new ParsingConfig
+{
+ ConvertObjectToSupportComparison = true
+};
+
+var results = persons.Where(config, "Age > 50").ToList();
+
+
+
+ Declaration
+
+
public bool ConvertObjectToSupportComparison { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ CustomTypeProvider
+
+
+ Declaration
+
+
public IDynamicLinkCustomTypeProvider CustomTypeProvider { get; set; }
+
+ Property Value
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ DateTimeIsParsedAsUTC
+ By default, a DateTime (like 'Fri, 10 May 2019 11:03:17 GMT') is parsed as local time.
+Use this flag to parse all DateTime strings as UTC.
+
Default value is false.
+
+
+ Declaration
+
+
public bool DateTimeIsParsedAsUTC { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Default
+
+
+ Declaration
+
+
public static ParsingConfig Default { get; }
+
+ Property Value
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ DefaultCosmosDb
+ Default ParsingConfig for CosmosDb
+
+
+ Declaration
+
+
public static ParsingConfig DefaultCosmosDb { get; }
+
+ Property Value
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ DefaultEFCore21
+ Default ParsingConfig for EntityFramework Core 2.1 and higher
+
+
+ Declaration
+
+
public static ParsingConfig DefaultEFCore21 { get; }
+
+ Property Value
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ DisableMemberAccessToIndexAccessorFallback
+ By default, when a member is not found in a type and the type has a string based index accessor it will be parsed as an index accessor.
+Use this flag to disable this behaviour and have parsing fail when parsing an expression where a member access on a non-existing member happens.
+
Default value is false.
+
+
+ Declaration
+
+
public bool DisableMemberAccessToIndexAccessorFallback { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ DisallowNewKeyword
+ Disallows the New() keyword to be used to construct a class.
+
Default value is false.
+
+
+ Declaration
+
+
public bool DisallowNewKeyword { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ EvaluateGroupByAtDatabase
+
+
+ Declaration
+
+
public bool EvaluateGroupByAtDatabase { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+
+
+
+ Declaration
+
+
public IExpressionPromoter ExpressionPromoter { get; set; }
+
+ Property Value
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ IsCaseSensitive
+ Gets or sets if parameter, method, and properties resolution should be case-sensitive or not.
+
Default value is false.
+
+
+ Declaration
+
+
public bool IsCaseSensitive { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ LoadAdditionalAssembliesFromCurrentDomainBaseDirectory
+ Load additional assemblies from the current domain base directory.
+Note: only used when full .NET Framework and .NET Core App 2.x and higher.
+
Default value is false.
+
+
+ Declaration
+
+
public bool LoadAdditionalAssembliesFromCurrentDomainBaseDirectory { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ NullPropagatingUseDefaultValueForNonNullableValueTypes
+ When using the NullPropagating function np(...), use a "default value" for non-nullable value types instead of "null value".
+
Default value is false.
+
+
+ Declaration
+
+
public bool NullPropagatingUseDefaultValueForNonNullableValueTypes { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ NumberParseCulture
+ The number parsing culture.
+
Default value is CultureInfo.InvariantCulture
+
+
+ Declaration
+
+
public CultureInfo NumberParseCulture { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Globalization.CultureInfo
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ PrioritizePropertyOrFieldOverTheType
+ When the type and property have the same name the parser takes the property instead of type when this setting is set to true.
+This setting is also used for calling ExtensionMethods.
+
Default value is true.
+
+
+ Declaration
+
+
public bool PrioritizePropertyOrFieldOverTheType { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ QueryableAnalyzer
+
+
+ Declaration
+
+
public IQueryableAnalyzer QueryableAnalyzer { get; set; }
+
+ Property Value
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ RenameEmptyParameterExpressionNames
+ Prevents any System.Linq.Expressions.ParameterExpression.Name value from being empty by substituting a random 16 character word.
+
Default value is false.
+
+
+ Declaration
+
+
public bool RenameEmptyParameterExpressionNames { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ RenameParameterExpression
+ Renames the (Typed)ParameterExpression empty Name to the correct supplied name from it.
+
Default value is false.
+
+
+ Declaration
+
+
public bool RenameParameterExpression { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ResolveTypesBySimpleName
+ By default, finding types by a simple name is not supported.
+Use this flag to use the CustomTypeProvider to resolve types by a simple name like "Employee" instead of "MyDatabase.Entities.Employee".
+Note that a first matching type is returned and this functionality needs to scan all types from all assemblies, so use with caution.
+
Default value is false.
+
+
+ Declaration
+
+
public bool ResolveTypesBySimpleName { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ StringLiteralParsing
+ Defines the type of string literal parsing that will be performed.
+Default value is StringLiteralParsingType.Default.
+
+
+ Declaration
+
+
public StringLiteralParsingType StringLiteralParsing { get; set; }
+
+ Property Value
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SupportCastingToFullyQualifiedTypeAsString
+ Support casting to a full qualified type using a string (double-quoted value).
+
var result = queryable.Select($"\"System.DateTime\"(LastUpdate)");
+
Default value is true.
+
+
+ Declaration
+
+
public bool SupportCastingToFullyQualifiedTypeAsString { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SupportDotInPropertyNames
+ Support a "." in a property-name. Used in the 'new (a.b as a.b)' syntax.
+
Default value is false.
+
+
+ Declaration
+
+
public bool SupportDotInPropertyNames { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ SupportEnumerationsFromSystemNamespace
+ Support enumeration-types from the System namespace in mscorlib. An example could be "StringComparison".
+
Default value is true.
+
+
+ Declaration
+
+
public bool SupportEnumerationsFromSystemNamespace { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ TypeConverters
+ Additional TypeConverters
+
+
+ Declaration
+
+
public IDictionary<Type, TypeConverter> TypeConverters { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Collections.Generic.IDictionary <System.Type , System.ComponentModel.TypeConverter >
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ UseParameterizedNamesInDynamicQuery
+
+
+ Declaration
+
+
public bool UseParameterizedNamesInDynamicQuery { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.Tokenizer.TextParser.html b/docs/api/System.Linq.Dynamic.Core.Tokenizer.TextParser.html
new file mode 100644
index 000000000..c3c09f633
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.Tokenizer.TextParser.html
@@ -0,0 +1,360 @@
+
+
+
+
+
+
+
+
Class TextParser
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class TextParser
+
+ TextParser which can be used to parse a text into tokens.
+
+
+
+
Inheritance
+
System.Object
+
TextParser
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public class TextParser
+
+ Constructors
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ TextParser(ParsingConfig, String)
+ Constructor for TextParser
+
+
+ Declaration
+
+
public TextParser(ParsingConfig config, string text)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ ParsingConfig
+ config
+
+
+
+ System.String
+ text
+
+
+
+
+ Fields
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+ CurrentToken
+ The current parsed Token .
+
+
+ Declaration
+
+
public Token CurrentToken
+
+ Field Value
+
+
+
+ Type
+ Description
+
+
+
+
+ Token
+
+
+
+
+ Methods
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Clone()
+ This method is used to clone the current TextParser .
+
+
+ Declaration
+
+
public TextParser Clone()
+
+ Returns
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ NextToken()
+
+
+ Declaration
+
+
public void NextToken()
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ PeekNextChar()
+ Peek the next character.
+
+
+ Declaration
+
+
public char PeekNextChar()
+
+ Returns
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Char
+ The next character, or \0 if end of string.
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ValidateToken(TokenId, String)
+ Check if the current token is the specified TokenId .
+
+
+ Declaration
+
+
public void ValidateToken(TokenId tokenId, string errorMessage = null)
+
+ Parameters
+
+
+
+ Type
+ Name
+ Description
+
+
+
+
+ TokenId
+ tokenId
+ The tokenId to check.
+
+
+
+ System.String
+ errorMessage
+ The (optional) error message.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.Tokenizer.Token.html b/docs/api/System.Linq.Dynamic.Core.Tokenizer.Token.html
new file mode 100644
index 000000000..423b49a88
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.Tokenizer.Token.html
@@ -0,0 +1,284 @@
+
+
+
+
+
+
+
+
Struct Token
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Struct Token
+
+
+
+
+
Inherited Members
+
+ System.ValueType.Equals(System.Object)
+
+
+ System.ValueType.GetHashCode()
+
+
+ System.ValueType.ToString()
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetType()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+ Properties
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Id
+
+
+ Declaration
+
+
public TokenId Id { readonly get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ TokenId
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ OriginalId
+
+
+ Declaration
+
+
public TokenId OriginalId { readonly get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ TokenId
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Pos
+
+
+ Declaration
+
+
public int Pos { readonly get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Int32
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Text
+
+
+ Declaration
+
+
public string Text { readonly get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.String
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.Tokenizer.TokenId.html b/docs/api/System.Linq.Dynamic.Core.Tokenizer.TokenId.html
new file mode 100644
index 000000000..1a45b514c
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.Tokenizer.TokenId.html
@@ -0,0 +1,305 @@
+
+
+
+
+
+
+
+
Enum TokenId
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Enum TokenId
+
+ TokenId which defines the text which is parsed.
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+ Fields
+
+
+
+
+ Name
+ Description
+
+
+
+
+ Ampersand
+
+
+
+ Asterisk
+
+
+
+ Bar
+
+
+
+ CloseBracket
+
+
+
+ CloseCurlyParen
+
+
+
+ CloseParen
+
+
+
+ Colon
+
+
+
+ Comma
+
+
+
+ Dot
+
+
+
+ DoubleAmpersand
+
+
+
+ DoubleBar
+
+
+
+ DoubleEqual
+
+
+
+ DoubleGreaterThan
+
+
+
+ DoubleLessThan
+
+
+
+ End
+
+
+
+ Equal
+
+
+
+ Exclamation
+
+
+
+ ExclamationEqual
+
+
+
+ GreaterThan
+
+
+
+ GreaterThanEqual
+
+
+
+ Identifier
+
+
+
+ IntegerLiteral
+
+
+
+ Lambda
+
+
+
+ LessGreater
+
+
+
+ LessThan
+
+
+
+ LessThanEqual
+
+
+
+ Minus
+
+
+
+ NullCoalescing
+
+
+
+ NullPropagation
+
+
+
+ OpenBracket
+
+
+
+ OpenCurlyParen
+
+
+
+ OpenParen
+
+
+
+ Percent
+
+
+
+ Plus
+
+
+
+ Question
+
+
+
+ RealLiteral
+
+
+
+ Slash
+
+
+
+ StringLiteral
+
+
+
+ Unknown
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.Tokenizer.html b/docs/api/System.Linq.Dynamic.Core.Tokenizer.html
new file mode 100644
index 000000000..dad26072e
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.Tokenizer.html
@@ -0,0 +1,139 @@
+
+
+
+
+
+
+
+
Namespace System.Linq.Dynamic.Core.Tokenizer
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+ Namespace System.Linq.Dynamic.Core.Tokenizer
+
+
+
+
+ Classes
+
+
+ TextParser which can be used to parse a text into tokens.
+
+ Structs
+
+
+
+ Enums
+
+
+ TokenId which defines the text which is parsed.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.Util.Cache.CacheConfig.html b/docs/api/System.Linq.Dynamic.Core.Util.Cache.CacheConfig.html
new file mode 100644
index 000000000..3542737c7
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.Util.Cache.CacheConfig.html
@@ -0,0 +1,301 @@
+
+
+
+
+
+
+
+
Class CacheConfig
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class CacheConfig
+
+ Cache Configuration Options
+
+
+
+
Inheritance
+
System.Object
+
CacheConfig
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public class CacheConfig
+
+ Properties
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ CleanupFrequency
+ Sets the frequency for running the cleanup process in the Constant Expression cache.
+By default, cleanup occurs every 10 minutes.
+
+
+ Declaration
+
+
public TimeSpan CleanupFrequency { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.TimeSpan
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ MinItemsTrigger
+ Configures the minimum number of items required in the constant expression cache before triggering cleanup.
+This prevents frequent cleanups, especially in caches with few items.
+A default value of null implies that cleanup is always allowed to run, helping in timely removal of unused cache items.
+
+
+ Declaration
+
+
public int? MinItemsTrigger { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Nullable <System.Int32 >
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ ReturnExpiredItems
+ Enables returning expired cache items in scenarios where cleanup, running on a separate thread,
+has not yet removed them. This allows for the retrieval of an expired object without needing to
+clear and recreate it if a request is made concurrently with cleanup. Particularly useful
+when cached items are deterministic, ensuring consistent results even from expired entries.
+Default true;
+
+
+ Declaration
+
+
public bool ReturnExpiredItems { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.Boolean
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ TimeToLive
+ Sets a Time-To-Live (TTL) for items in the constant expression cache to prevent uncontrolled growth.
+Items not accessed within this TTL will be expired, allowing garbage collection to reclaim the memory.
+Default is 10 minutes.
+
+
+ Declaration
+
+
public TimeSpan TimeToLive { get; set; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ System.TimeSpan
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.Util.Cache.html b/docs/api/System.Linq.Dynamic.Core.Util.Cache.html
new file mode 100644
index 000000000..07c6dbdb5
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.Util.Cache.html
@@ -0,0 +1,129 @@
+
+
+
+
+
+
+
+
Namespace System.Linq.Dynamic.Core.Util.Cache
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+ Namespace System.Linq.Dynamic.Core.Util.Cache
+
+
+
+
+ Classes
+
+
+ Cache Configuration Options
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Linq.Dynamic.Core.html b/docs/api/System.Linq.Dynamic.Core.html
new file mode 100644
index 000000000..319b0e48f
--- /dev/null
+++ b/docs/api/System.Linq.Dynamic.Core.html
@@ -0,0 +1,173 @@
+
+
+
+
+
+
+
+
Namespace System.Linq.Dynamic.Core
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+ Namespace System.Linq.Dynamic.Core
+
+
+
+
+ Classes
+
+
+ Default implementation.
+
+
+ Provides a base class for dynamic objects for Net 3.5
+
+
+
+
+ Define extensions on System.Collections.IEnumerable .
+
+
+ Helper class to convert an expression into an LambdaExpression
+
+
+
+
+ Provides a set of static (Shared in Visual Basic) methods for querying data structures that implement System.Linq.IQueryable .
+It allows dynamic string based querying. Very handy when, at compile time, you don't know the type of queries that will be generated,
+or when downstream components only return column names to sort and filter by.
+
+
+ Extensibility point: If you want to modify expanded queries before executing them
+set your own functionality to override empty QueryOptimizer
+
+
+
+
+
+
+
+
+ Configuration class for System.Linq.Dynamic.Core.
+
+ Interfaces
+
+
+ IAssemblyHelper interface which is used to retrieve assemblies that have been loaded into the execution context of this application domain.
+
+
+ Interface for QueryableAnalyzer.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.Tuple-2.html b/docs/api/System.Tuple-2.html
new file mode 100644
index 000000000..2496bb24f
--- /dev/null
+++ b/docs/api/System.Tuple-2.html
@@ -0,0 +1,251 @@
+
+
+
+
+
+
+
+
Class Tuple<T1, T2>
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+
+ Class Tuple<T1, T2>
+
+ Represents a 2-tuple, or pair.
+
+
+
+
Inheritance
+
System.Object
+
Tuple<T1, T2>
+
+
+
Inherited Members
+
+ System.Object.ToString()
+
+
+ System.Object.Equals(System.Object)
+
+
+ System.Object.Equals(System.Object, System.Object)
+
+
+ System.Object.ReferenceEquals(System.Object, System.Object)
+
+
+ System.Object.GetHashCode()
+
+
+ System.Object.GetType()
+
+
+ System.Object.MemberwiseClone()
+
+
+
+ Assembly : System.Linq.Dynamic.Core.dll
+ Syntax
+
+
public class Tuple<T1, T2>
+
+ Type Parameters
+
+
+
+ Name
+ Description
+
+
+
+
+ T1
+ The type of the tuple's first component.
+
+
+
+ T2
+ The type of the tuple's second component.
+
+
+
+
+ Properties
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Item1
+ The value of the current System.Tuple`2 object's first component.
+
+
+ Declaration
+
+
public T1 Item1 { get; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ T1
+
+
+
+
+
+ |
+ Improve this Doc
+
+
+ View Source
+
+
+ Item2
+ The value of the current System.Tuple`2 object's second component.
+
+
+ Declaration
+
+
public T2 Item2 { get; }
+
+ Property Value
+
+
+
+ Type
+ Description
+
+
+
+
+ T2
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/System.html b/docs/api/System.html
new file mode 100644
index 000000000..0b290949f
--- /dev/null
+++ b/docs/api/System.html
@@ -0,0 +1,129 @@
+
+
+
+
+
+
+
+
Namespace System
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+
+
+
+ Namespace System
+
+
+
+
+ Classes
+
+
+ Represents a 2-tuple, or pair.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/api/toc.html b/docs/api/toc.html
new file mode 100644
index 000000000..ca7a1c1e5
--- /dev/null
+++ b/docs/api/toc.html
@@ -0,0 +1,165 @@
+
+
\ No newline at end of file
diff --git a/docs/favicon.ico b/docs/favicon.ico
new file mode 100644
index 000000000..71570f61e
Binary files /dev/null and b/docs/favicon.ico differ
diff --git a/web/DynamicLinqWebDocs/fonts/glyphicons-halflings-regular.eot b/docs/fonts/glyphicons-halflings-regular.eot
similarity index 100%
rename from web/DynamicLinqWebDocs/fonts/glyphicons-halflings-regular.eot
rename to docs/fonts/glyphicons-halflings-regular.eot
diff --git a/web/DynamicLinqWebDocs/fonts/glyphicons-halflings-regular.svg b/docs/fonts/glyphicons-halflings-regular.svg
similarity index 100%
rename from web/DynamicLinqWebDocs/fonts/glyphicons-halflings-regular.svg
rename to docs/fonts/glyphicons-halflings-regular.svg
diff --git a/web/DynamicLinqWebDocs/fonts/glyphicons-halflings-regular.ttf b/docs/fonts/glyphicons-halflings-regular.ttf
similarity index 100%
rename from web/DynamicLinqWebDocs/fonts/glyphicons-halflings-regular.ttf
rename to docs/fonts/glyphicons-halflings-regular.ttf
diff --git a/web/DynamicLinqWebDocs/fonts/glyphicons-halflings-regular.woff b/docs/fonts/glyphicons-halflings-regular.woff
similarity index 100%
rename from web/DynamicLinqWebDocs/fonts/glyphicons-halflings-regular.woff
rename to docs/fonts/glyphicons-halflings-regular.woff
diff --git a/web/DynamicLinqWebDocs/fonts/glyphicons-halflings-regular.woff2 b/docs/fonts/glyphicons-halflings-regular.woff2
similarity index 100%
rename from web/DynamicLinqWebDocs/fonts/glyphicons-halflings-regular.woff2
rename to docs/fonts/glyphicons-halflings-regular.woff2
diff --git a/docs/fti/FTI_100.json b/docs/fti/FTI_100.json
deleted file mode 100644
index 4db0e0056..000000000
--- a/docs/fti/FTI_100.json
+++ /dev/null
@@ -1 +0,0 @@
-{"dynamicfunctions":[13828100,21757954],"dictionary":[12779521,17629185],"data":[393217,1179649,1769473,5505025,9306113,9633793,11141129,12779529,17629185,19660801,20185097,21757953,22872065,23003137],"defined":[393217,5046273,9306113,17629185,18808833],"defines":[3932161],"defaultvalue":[22675459],"distinct":[8323074,9830406,23003138],"database":[983041,2686977,4915201,5636097,5963777,7340033,8847366,12910593,13238273,13565958,16056326,16187393,16842753,17694721,19791873,20185089,21364737,22609921],"defaultifempty":[8323074,10616835,19136516,22675460,23003138],"dynamically":[983041,1179649,2686977,4915201,5636097,8323073,11141121,12779521,12910593,13238273,16187393,16842753,17694721,20185089,21364737,22609921,23003137],"description":[131073,262145,327681,393219,655361,851969,1441793,1572865,1769473,1900545,2162689,2228225,2293761,2359297,2490369,2752513,2949121,3145729,3211266,3342338,3407873,3473409,3670017,3866625,4128769,4456449,4718593,5046273,5111809,5308417,5373953,5570561,5898241,5963777,6553601,6684673,6750209,7012355,7077889,7208961,7340035,7471105,7864321,7929857,8060929,8126465,8323073,8454145,8585217,8781825,8847361,8978433,9240577,9306113,9764865,10027009,10158081,10420225,10485763,10551297,10616833,10878977,11141121,11206659,11403265,11534337,12189698,12451841,12713985,12779521,13434881,13565953,14352385,14548993,14614529,14680065,15007745,15335425,15466497,15663105,15728641,16056321,16121857,16777217,16908291,17039361,17498113,17629186,17760257,17956865,18284547,18415617,18808835,19202049,19398657,19464193,19595267,19660801,20447235,20578305,20840449,20971521,21102594,21299201,21626882,21757953,22151169,22806529,22872065,22937601,23003137,23068673],"dynamic":[65537,131074,196613,262146,327682,393223,458757,524293,589836,655362,720897,786438,851970,917510,983045,1048581,1114118,1179653,1245189,1310725,1376257,1441794,1507333,1572865,1638409,1703941,1769475,1835013,1900545,1966085,2031625,2097153,2162690,2228225,2293762,2359298,2424837,2490370,2555909,2621445,2686982,2752514,2818049,2883595,2949122,3014662,3080197,3145730,3211270,3276805,3342343,3407873,3473410,3538949,3604485,3670017,3735558,3801093,3866626,3932165,3997701,4063237,4128770,4194309,4259841,4325381,4390917,4456449,4521985,4587521,4653068,4718594,4784136,4849669,4915206,4980742,5046275,5111817,5177350,5242900,5308418,5373953,5439489,5505029,5570564,5636102,5701633,5767169,5832709,5898242,5963782,6029313,6094854,6160385,6225925,6291457,6356997,6422533,6488070,6553602,6619141,6684676,6750211,6815749,6881285,6946824,7012358,7077889,7143429,7208969,7274502,7340043,7405573,7471106,7536641,7602177,7667721,7733254,7798795,7864321,7929858,7995400,8060930,8126465,8192022,8257537,8323075,8388609,8454146,8519685,8585218,8650757,8716293,8781826,8847362,8912901,8978437,9043973,9109509,9175051,9240578,9306114,9371653,9437189,9502725,9568261,9633797,9699333,9764865,9830405,9895944,9961477,10027010,10092550,10158085,10223622,10289157,10354693,10420227,10485767,10551298,10616834,10682373,10747909,10813441,10878978,10944517,11010049,11075585,11141124,11206662,11272197,11337729,11403266,11468805,11534338,11599877,11665417,11730950,11796485,11862042,11927557,11993089,12058625,12124165,12189705,12255233,12320774,12386310,12451841,12517381,12582918,12648454,12713986,12779529,12845061,12910598,12976129,13041670,13107205,13172742,13238278,13303814,13369355,13434882,13500421,13565958,13631493,13697029,13762565,13828097,13893638,13959169,14024709,14090245,14155777,14221318,14286849,14352386,14417932,14483461,14548997,14614530,14680066,14745620,14811143,14876683,14942213,15007745,15073285,15138822,15204357,15269889,15335426,15400965,15466501,15532037,15597582,15663109,15728642,15794181,15859718,15925254,15990789,16056322,16121858,16187399,16252934,16318469,16384009,16449542,16515078,16580609,16646149,16711685,16777217,16842757,16908295,16973829,17039362,17104901,17170439,17235973,17301505,17367046,17432577,17498113,17563653,17629191,17694725,17760258,17825797,17891337,17956866,18022408,18087942,18153478,18219013,18284550,18350081,18415617,18481157,18546689,18612229,18677765,18743297,18808847,18874373,18939905,19005445,19070977,19136517,19202050,19267590,19333126,19398661,19464197,19529733,19595270,19660802,19726358,19791877,19857409,19922949,19988486,20054017,20119563,20185095,20250629,20316166,20381697,20447240,20512773,20578306,20643848,20709382,20774917,20840450,20905985,20971522,21037076,21102599,21168133,21233670,21299202,21364743,21430281,21495819,21561349,21626883,21692421,21757955,21823493,21889025,21954566,22020099,22085638,22151169,22216709,22282241,22347781,22413313,22478853,22544389,22609926,22675461,22740997,22806537,22872066,22937606,23003144,23068674],"dynamiclinqcustomtypeprovider":[3211265,21102593],"disablememberaccesstoindexaccessorfallback":[1507330,5963777,7340033],"defaultdynamiclinqcustomtypeprovider":[3211266,3932164,5308418,7733250,10420227,10551298,12189702,18481154,21102594,22740994],"dynamiclinq":[65538,131074,196610,262146,327682,393218,458754,524290,589826,655362,720902,786434,851970,917506,983042,1048578,1114114,1179650,1245186,1310722,1376262,1441794,1507330,1572867,1638402,1703938,1769475,1835010,1900547,1966082,2031618,2097158,2162690,2228226,2293762,2359298,2424834,2490370,2555906,2621442,2686978,2752514,2818054,2883586,2949122,3014658,3080194,3145730,3211266,3276802,3342338,3407875,3473410,3538946,3604482,3670019,3735554,3801090,3866626,3932162,3997698,4063234,4128770,4194306,4259846,4325378,4390914,4456451,4521990,4587526,4653058,4718594,4784130,4849666,4915202,4980738,5046274,5111810,5177346,5242882,5308418,5373955,5439494,5505026,5570562,5636098,5701638,5767174,5832706,5898242,5963778,6029318,6094850,6160390,6225922,6291462,6356994,6422530,6488066,6553602,6619138,6684674,6750210,6815746,6881282,6946818,7012354,7077891,7143426,7208962,7274498,7340034,7405570,7471106,7536646,7602182,7667714,7733250,7798786,7864323,7929858,7995394,8060930,8126467,8192002,8257542,8323074,8388614,8454146,8519682,8585218,8650754,8716290,8781826,8847362,8912898,8978434,9043970,9109506,9175042,9240578,9306114,9371650,9437186,9502722,9568258,9633794,9699330,9764867,9830402,9895938,9961474,10027010,10092546,10158082,10223618,10289154,10354690,10420226,10485762,10551298,10616834,10682370,10747906,10813446,10878978,10944514,11010054,11075590,11141122,11206658,11272194,11337734,11403266,11468802,11534338,11599874,11665410,11730946,11796482,11862018,11927554,11993094,12058630,12124162,12189698,12255238,12320770,12386306,12451843,12517378,12582914,12648450,12713986,12779522,12845058,12910594,12976134,13041666,13107202,13172738,13238274,13303810,13369346,13434882,13500418,13565954,13631490,13697026,13762562,13828105,13893634,13959174,14024706,14090242,14155782,14221314,14286854,14352386,14417922,14483458,14548994,14614530,14680066,14745602,14811138,14876674,14942210,15007747,15073282,15138818,15204354,15269894,15335426,15400962,15466498,15532034,15597570,15663106,15728642,15794178,15859714,15925250,15990786,16056322,16121858,16187394,16252930,16318466,16384002,16449538,16515074,16580614,16646146,16711682,16777219,16842754,16908290,16973826,17039362,17104898,17170434,17235970,17301510,17367042,17432582,17498115,17563650,17629186,17694722,17760258,17825794,17891330,17956866,18022402,18087938,18153474,18219010,18284546,18350086,18415619,18481154,18546694,18612226,18677762,18743302,18808834,18874370,18939910,19005442,19070978,19136514,19202050,19267586,19333122,19398658,19464194,19529730,19595266,19660807,19726338,19791874,19857410,19922946,19988482,20054022,20119554,20185090,20250626,20316162,20381702,20447234,20512770,20578306,20643842,20709378,20774914,20840450,20905990,20971522,21037058,21102594,21168130,21233666,21299202,21364738,21430274,21495810,21561346,21626882,21692418,21757955,21823490,21889030,21954562,22020098,22085634,22151171,22216706,22282246,22347778,22413318,22478850,22544386,22609922,22675458,22740994,22806530,22872071,22937602,23003138,23068674],"dynamicclassfactory":[11141123,12779524,17629185,20185091],"defaultefcore21":[5963777,7340033,14024706],"details":[1441794,8323074,20709377,22347777,23003138],"datetime":[20185090],"defaultqueryableanalyzer":[1245188,3342342,15990786,16121859,17629185],"destination":[5505025,14548993,21626881],"dynamicobject":[1638402,3801089,5111810,7995395,18808836,19988481],"define":[7208961,17629186,22806529],"dynamicproperties":[20185089],"describes":[393217,9306113,10747905],"derived":[393218,1638402,3866627,5111810,5505025,7995395,10027009,17760258,18808834,20447236],"documentation":[589831,2228225,2883590,4653063,5242887,7667716,7798790,8192008,9175046,11665412,11862026,13369350,14417927,14745607,14876678,15597577,16384004,18022403,19726344,20119558,20643843,21037063,21430276,21495814,21626881],"dynamicenumerableasyncextensions":[1114114,7274498,10158082,13172738,15466498,16384006,17629185,18022405,21299202,21430278,22806531],"dimensional":[1835009,8323076,10878980,13631489,15925249,21954561,23003140],"determines":[393217,655361,1638401,2752513,3145729,3342338,4456451,4718593,5373955,5963777,6094849,7012353,7340034,7471105,7602177,7995393,8126467,8257537,8323076,8585217,8978433,9240580,10420225,10485761,11206657,12189697,12713985,12976129,13697025,14155777,14352385,15204353,15269889,15990785,16121858,16908289,17039361,17760257,17825793,18284545,18415619,18939905,19595265,19660803,20316161,21102593,21692417,22872067,23003140],"descending":[2490370,3080193,8323074,13041665,23003138],"duplicate":[9830401],"dynamiclinqtypeattribute":[655362,2555905,3211266,3866627,9699329,10027011,10420226,12189699,17563652,20447238,21102594],"disable":[1507329,5963777,7340033],"dynamicclass":[1638402,4128771,4849666,5111811,5570562,5832708,6488066,6684674,7995394,11141121,12779521,16252930,17170434,17629185,18808838,19267586,19333122,20185095],"desc":[3080194,11730946,13041666,18612226],"domain":[524289,655362,2949121,3211265,3932161,5308418,6750210,10420228,10551298,11141123,12189701,12517377,12779523,14942209,15532033,16711682,17629185,18481153,19464194,20185091,21102594,22740993,22937602],"downstream":[1769473,17629185,19660801,21757953,22872065,23003137],"default":[1,393217,655361,720898,1376258,1507330,1900547,1966082,2031617,2097154,2359300,2424834,2752513,3014657,3145729,3211266,3342338,3670019,3866625,3932161,3997698,4194305,4259842,4587522,4718593,4784129,5373961,5439489,5898242,5963789,6160386,6291458,6553601,6946817,7012353,7077891,7143427,7340046,7471105,7536641,7929858,8126473,8323091,8585217,9109505,9371650,9568257,9764867,9830401,9961473,10420225,10485761,10616834,11010050,11075586,11206658,11272193,11796481,11993090,12189699,12255234,12386305,12713985,13631490,13762561,13893634,13959170,14024705,14286850,14811137,15335428,16121857,16777219,16908289,17039361,17498115,17629186,17760257,17891329,18087937,18284545,18808833,19136515,19595265,19660809,19791873,20054018,20185089,20316161,20381698,20447233,20774914,20840452,21102593,21823490,21889026,21954562,22675458,22872073,23003155],"dll":[196609,393217,458753,524289,589825,720897,786433,917505,983041,1048577,1114113,1179649,1245185,1310721,1376257,1507329,1638401,1703937,1835009,1966081,2031617,2097153,2424833,2555905,2621441,2686977,2818049,2883585,3014657,3080193,3276801,3342337,3538945,3604481,3735553,3801089,3932161,3997697,4063233,4194305,4259841,4325377,4390913,4521985,4587521,4653057,4784129,4849665,4915201,4980737,5177345,5242881,5439489,5505025,5636097,5701633,5767169,5832705,6029313,6094849,6160385,6225921,6291457,6356993,6422529,6488065,6619137,6815745,6881281,6946817,7012353,7143425,7208961,7274497,7340033,7405569,7536641,7602177,7667713,7733249,7798785,7995393,8192001,8257537,8388609,8519681,8650753,8716289,8912897,8978433,9043969,9109505,9175041,9371649,9437185,9502721,9568257,9633793,9699329,9830401,9895937,9961473,10092545,10223617,10289153,10354689,10485761,10682369,10747905,10813441,10944513,11010049,11075585,11206657,11272193,11337729,11468801,11599873,11665409,11730945,11796481,11862017,11927553,11993089,12058625,12124161,12189697,12255233,12320769,12386305,12517377,12582913,12648449,12779521,12845057,12910593,12976129,13041665,13107201,13172737,13238273,13303809,13369345,13500417,13565953,13631489,13697025,13762561,13828098,13893633,13959169,14024705,14090241,14155777,14221313,14286849,14417921,14483457,14548993,14745601,14811137,14876673,14942209,15073281,15138817,15204353,15269889,15400961,15532033,15597569,15794177,15859713,15925249,15990785,16187393,16252929,16318465,16384001,16449537,16515073,16580609,16646145,16711681,16842753,16908289,16973825,17104897,17170433,17235969,17301505,17367041,17432577,17563649,17694721,17825793,17891329,18022401,18087937,18153473,18219009,18284545,18350081,18481153,18546689,18612225,18677761,18743297,18808833,18874369,18939905,19005441,19136513,19267585,19333121,19464193,19529729,19595265,19660801,19726337,19791873,19922945,19988481,20054017,20119553,20185089,20250625,20316161,20381697,20447233,20512769,20643841,20709377,20774913,20905985,21037057,21102593,21168129,21233665,21364737,21430273,21495809,21561345,21692417,21823489,21889025,21954561,22020097,22085633,22216705,22282241,22347777,22413313,22478849,22544385,22609921,22675457,22740993,22806529,22872065,22937601,23003137],"dynamicqueryableextensions":[131074,327682,589833,851970,917506,1179650,1310722,1441794,1835010,1966082,2031618,2162690,2359298,2424834,2490370,2883592,3014658,3080194,3735554,3801090,3997698,4390914,4653065,4784130,4980738,5177346,5242889,5898242,6094850,6356994,6422530,6619138,6815746,6881282,6946818,7012353,7798792,7929858,8060930,8323075,8454146,8781826,8912898,9043970,9175048,9240578,9502722,9568258,9830402,9895938,9961474,10092546,10223618,10354690,10616834,10682370,10878978,10944514,11272194,11403266,11468802,11599874,11730946,11862028,12320770,12582914,13041666,13107202,13303810,13369352,13434882,13631490,13697026,13762562,13893634,14090242,14221314,14417929,14483458,14680066,14745609,14876680,15073282,15138818,15204354,15335426,15597579,15728642,15794178,15925250,16318466,16449538,16646146,16973826,17104898,17629186,17825794,17891330,17956866,18087938,18153474,18219010,18612226,18874370,19005442,19136514,19202050,19529730,19922946,19988482,20119560,20250626,20709378,20774914,20840450,21168130,21233666,21495816,21823490,21954562,22085634,22347778,22478850,22544386,22675458,23003140,23068674],"dynamicproperty":[2293763,3538948,4325378,8519682,8585219,17629186,19595271,20185094],"dynamicenumerableextensions":[7208963,7667718,11534338,11665414,15663106,15859714,16515074,17367042,17629185,19398658,20643845],"docs":[5963777,7340033,19791873],"destionation":[9633793],"dynamicexpressionparser":[983042,2686978,4915202,5636098,8192010,8847362,12910594,13238274,13565955,16056322,16187394,16842754,17629185,17694722,19726346,21037065,21364738,22609922]}
\ No newline at end of file
diff --git a/docs/fti/FTI_101.json b/docs/fti/FTI_101.json
deleted file mode 100644
index 56c4ca457..000000000
--- a/docs/fti/FTI_101.json
+++ /dev/null
@@ -1 +0,0 @@
-{"examples":[917505,1835009,3080193,3801089,4980737,6094849,6356993,6422529,6881281,8912897,9830401,10092545,10223617,10354689,10682369,11599873,11730945,12582913,13041665,13303809,13631489,14090241,15138817,15204353,15925249,16318465,17825793,18153473,18612225,19136513,19922945,19988481,20185089,20709377,21233665,21954561,22347777,22675457],"exact":[9633795],"exception":[393240,655361,1376257,1638401,1900547,2359300,4390913,5373955,5439489,5505026,7077891,7536641,7995393,8126467,8323080,9306127,9568257,9699329,10420225,11010049,11272193,11403268,12189697,12320769,13500418,13959169,14286849,17104897,17760263,18087937,19529729,19660803,20774913,21102593,22872067,23003144],"employees":[6094849,6356993,6422529,9830401,10092545,10682369,13303809,14090241,15204353,17825793,18153473,19136513,22675457],"exceptions":[393220,5046274,5505026,9306113,10747906,12845058,13500418,17760258],"entityframework":[65537,131073,196609,262145,327681,393217,458753,524289,589825,655361,720901,786433,851969,917505,983041,1048577,1114113,1179649,1245185,1310721,1376261,1441793,1507329,1572866,1638401,1703937,1769475,1835009,1900545,1966081,2031617,2097153,2162689,2228225,2293761,2359297,2424833,2490369,2555905,2621441,2686977,2752513,2818053,2883585,2949121,3014657,3080193,3145729,3211265,3276801,3342337,3407874,3473409,3538945,3604481,3670017,3735553,3801089,3866625,3932161,3997697,4063233,4128769,4194305,4259845,4325377,4390913,4456450,4521985,4587521,4653057,4718593,4784129,4849665,4915201,4980737,5046273,5111809,5177345,5242881,5308417,5373953,5439489,5505025,5570561,5636097,5701637,5767173,5832705,5898241,5963779,6029317,6094849,6160389,6225921,6291457,6356993,6422529,6488065,6553601,6619137,6684673,6750209,6815745,6881281,6946817,7012353,7077890,7143425,7208961,7274497,7340035,7405569,7471105,7536645,7602181,7667713,7733249,7798785,7864321,7929857,7995393,8060929,8126466,8192001,8257541,8323073,8388613,8454145,8519681,8585217,8650753,8716289,8781825,8847361,8912897,8978433,9043969,9109505,9175041,9240577,9306113,9371649,9437185,9502721,9568257,9633793,9699329,9764866,9830401,9895937,9961473,10027009,10092545,10158081,10223617,10289153,10354689,10420225,10485761,10551297,10616833,10682369,10747905,10813445,10878977,10944513,11010049,11075589,11141121,11206657,11272193,11337729,11403265,11468801,11534337,11599873,11665409,11730945,11796481,11862017,11927553,11993093,12058625,12124161,12189697,12255233,12320769,12386305,12451841,12517377,12582913,12648449,12713985,12779521,12845057,12910593,12976129,13041665,13107201,13172737,13238273,13303809,13369345,13434881,13500417,13565953,13631489,13697025,13762561,13828099,13893633,13959169,14024706,14090241,14155777,14221313,14286853,14352385,14417921,14483457,14548993,14614529,14680065,14745601,14811137,14876673,14942209,15007745,15073281,15138817,15204353,15269893,15335425,15400961,15466497,15532033,15597569,15663105,15728641,15794177,15859713,15925249,15990785,16056321,16121857,16187393,16252929,16318465,16384001,16449537,16515073,16580609,16646145,16711681,16777217,16842753,16908289,16973825,17039361,17104897,17170433,17235969,17301509,17367041,17432577,17498114,17563649,17629185,17694721,17760257,17825793,17891329,17956865,18022401,18087937,18153473,18219009,18284545,18350085,18415617,18481153,18546689,18612225,18677761,18743297,18808833,18874369,18939905,19005441,19070977,19136513,19202049,19267585,19333121,19398657,19464193,19529729,19595265,19660806,19726337,19791874,19857409,19922945,19988481,20054017,20119553,20185089,20250625,20316161,20381697,20447233,20512769,20578305,20643841,20709377,20774913,20840449,20905985,20971521,21037057,21102593,21168129,21233665,21299201,21364737,21430273,21495809,21561345,21626881,21692417,21757953,21823489,21889029,21954561,22020097,22085633,22151170,22216705,22282241,22347777,22413317,22478849,22544385,22609921,22675457,22740993,22806529,22872065,22937601,23003137,23068673],"execution":[2949121,16711681,17629185,19464194],"entities":[983041,2686977,4915201,5636097,5963777,7340033,8847366,9371649,12910593,13238273,13565958,16056326,16187393,16842753,17629185,17694721,18808833,21364737,22609921],"entityframeworkdynamicqueryableextensions":[720898,1376258,1572866,1769473,1900546,2097154,2818050,3407874,3670018,4259842,4456450,4521986,4587522,5373954,5439490,5701634,5767170,6029314,6160386,6291458,7077890,7536642,7602178,7864322,8126466,8257538,8388610,9764866,10813442,11010050,11075586,11337730,11993090,12058626,12255234,12451842,12976130,13959170,14155778,14286850,15007746,15269890,16580610,16777218,17301506,17432578,17498114,18350082,18415618,18546690,18743298,18939906,19660803,20054018,20381698,20905986,21757953,21889026,22151170,22282242,22413314,22872067],"extension":[589826,720898,917506,1114114,1179650,1310722,1376258,1835010,1966082,2031618,2097154,2424834,2818050,2883586,3014658,3080194,3735554,3801090,3997698,4259842,4390914,4521986,4587522,4653058,4784130,4980738,5177346,5242882,5439490,5701634,5767170,5963777,6029314,6094850,6160386,6291458,6356994,6422530,6619138,6815746,6881282,6946818,7274498,7340033,7536642,7602178,7667714,7798786,8257538,8388610,8912898,9043970,9175042,9502722,9568258,9830402,9895938,9961474,10092546,10223618,10354690,10682370,10813442,10944514,11010050,11075586,11272194,11337730,11468802,11599874,11665410,11730946,11862018,11993090,12058626,12255234,12320770,12582914,12976130,13041666,13107202,13172738,13303810,13369346,13631490,13697026,13762562,13893634,13959170,14090242,14155778,14221314,14286850,14417922,14483458,14745602,14876674,15073282,15138818,15204354,15269890,15597570,15794178,15859714,15925250,16318466,16384002,16449538,16515074,16580610,16646146,16973826,17104898,17301506,17367042,17432578,17825794,17891330,18022402,18087938,18153474,18219010,18350082,18546690,18612226,18743298,18874370,18939906,19005442,19136514,19529730,19791873,19922946,19988482,20054018,20119554,20250626,20381698,20643842,20709378,20774914,20905986,21168130,21233666,21430274,21495810,21823490,21889026,21954562,22085634,22282242,22347778,22413314,22478850,22544386,22675458],"errors":[393217,5046273],"expr":[9633794],"exposes":[262145,393217,655361,2293761,2752513,2949121,3145729,3342337,3473409,3866625,4128769,4718593,5111809,5963777,6553601,6750209,7012353,7340033,7471105,8323073,8585217,8978433,9306113,10027009,10420225,10485761,11141121,11206657,12189697,12713985,12779521,14352385,14548993,14614529,16121857,16908289,17039361,17760257,18284545,18808833,19464193,19595265,20447233,20578305,20971521,21102593,22937601,23003137],"evaluategroupbyatdatabase":[5963777,7340033,19791874],"expressionpromoter":[5963777,7340033,22216706],"extract":[2031618,4784130,6946818,17891330],"equivalent":[5963777,7340033,20316161],"equality":[2031618,4784129,5898244,6946818,7929858,8323079,9830401,11141121,12779521,17891329,20185089,23003143],"extensions":[1769473,7208961,17629186,21757953,22806529],"element":[131076,720902,917506,1376263,1441796,1572867,1835015,1900553,1966083,2031620,2097158,2359304,2424838,2818051,3014660,3670021,3735553,3801091,3997701,4259846,4390917,4456450,4521987,4587526,4784131,4980739,5177346,5373979,5439493,5701635,5767169,6094849,6160390,6291462,6356994,6815746,6881281,6946820,7077897,7536645,7602178,8126491,8257538,8323123,8388612,8781828,8912899,9502723,9568260,9764869,9961475,10092546,10223619,10354690,10682369,10813444,10878988,11010055,11075590,11272197,11337732,11403272,11468801,11599874,11993091,12058625,12255235,12320773,12451843,12582913,13107204,13303809,13631495,13762564,13893638,13959175,14090242,14155778,14221316,14286855,15007747,15073283,15138818,15204353,15335431,15794179,15925255,16318467,16449540,16580611,16777221,16973828,17104900,17301508,17432580,17498117,17891331,18087941,18153474,18350081,18415618,18546689,18874369,18939906,19529732,19660827,19922946,19988483,20054022,20250627,20381699,20709379,20774916,20840452,20905988,21233666,21823491,21889027,21954567,22151171,22282244,22347779,22413316,22544386,22872091,23003187],"equals":[393217,655361,2752513,3145729,3342337,3866626,4718593,7012353,7340033,7471105,8585217,10420225,10485761,11141121,11206657,12189697,12713985,12779521,16121857,16908289,17039361,17629185,17760257,18284545,18808833,19595265,20185089,20447234,21102593],"elements":[262146,327682,917506,1114113,1310724,1835010,1966081,2031618,2162690,2490370,2621441,3014657,3080194,3407875,3670017,3735555,3801089,4456449,4784130,4980737,5177346,5373958,5767171,5898242,6029315,6094850,6356995,6422531,6619140,6815746,6881281,6946818,7012354,7274497,7602178,7864323,7929858,8060931,8126470,8257538,8323123,8454147,8912897,9043971,9240580,9764865,9830403,9961473,10092547,10223617,10354690,10616834,10682371,11468803,11599874,11730946,11993089,12058627,12124161,12255233,12582913,12976130,13041666,13172737,13303811,13434884,13631490,13697026,13762561,14090242,14155778,14483457,14680067,15138818,15204354,15269890,15335425,15728644,15859713,15925250,16318465,16515073,16646148,16777217,17367041,17498113,17825794,17891330,17956870,18153474,18219014,18350083,18415617,18546691,18612226,18743299,18874371,18939906,19005444,19136513,19202049,19660806,19922946,19988481,20381697,20709377,20774913,20840452,21168131,21233666,21823489,21889025,21954562,22085636,22347777,22478850,22544386,22675457,22872070,23003187,23068673],"ensure":[720897,1376257,2097153,2818049,4259841,4521985,4587521,5439489,5701633,5767169,6029313,6160385,6291457,7536641,7602177,8257537,8388609,10813441,11010049,11075585,11337729,11993089,12058625,12255233,12976129,13959169,14155777,14286849,15269889,16580609,17301505,17432577,18350081,18546689,18743297,18939905,20054017,20381697,20905985,21889025,22282241,22413313],"exactly":[2359299,4390913,8323079,9568257,11272193,11403268,12320769,17104897,18087937,19529729,23003143],"expanded":[17629185,18284545],"existing":[1507329,5963777,7340033],"error":[393218,9306113,10747906,19857410],"expressions":[393217,786433,983041,2686977,3997697,4915201,5046273,5177345,6815745,8192009,9043969,9502721,9568257,9633793,9961473,13697025,14483457,15794177,17104897,17694721,22544385],"evaluating":[5963777,7340033,19791873],"empty":[720897,1966081,2097153,2359300,2424833,3997697,4259841,4587521,5963777,6094849,6160385,6291457,6356993,7340033,8323078,9568257,10092545,10616834,11075585,11272193,11796481,11993089,12255233,12976129,13697025,13893633,14090241,15204353,15269889,17629185,17825793,18087937,18153473,18284545,19136515,20054017,20381697,20774913,21823489,21889025,22675460,23003142],"example":[1638402,3473409,7405569,7995394,18284545],"extensibility":[3473409,7405569,17629185,18284546],"evaluate":[4194305,5963777,7340033],"employee":[5963778,7340034,9371650,22675457],"expressionoptimizer":[3473409,7405569,18284545],"entered":[19070977],"executing":[17629185,18284545],"expression":[458755,786435,917506,983044,1507329,2686980,3080193,3473409,3801089,3997697,4915204,4980737,5636101,5963778,6881281,7340034,7405573,8192005,8847371,8912897,9043969,9502721,9568257,9633800,9961473,10223617,10354690,11141121,11599873,11730945,12582913,12779521,12910597,13041665,13238276,13565964,13697025,14483457,14548994,15138817,15794177,16056331,16187397,16318465,16842756,17104897,17629185,17694724,18284545,18612225,19726341,19922946,19988481,20185089,20316161,20578305,20709377,21037061,21233666,21364741,21626881,22347777,22609924],"entityframeworkcore":[65537,131073,196609,262145,327681,393217,458753,524289,589825,655361,720897,786433,851969,917505,983041,1048577,1114113,1179649,1245185,1310721,1376257,1441793,1507329,1572865,1638401,1703937,1769473,1835009,1900546,1966081,2031617,2097157,2162689,2228225,2293761,2359297,2424833,2490369,2555905,2621441,2686977,2752513,2818049,2883585,2949121,3014657,3080193,3145729,3211265,3276801,3342337,3407873,3473409,3538945,3604481,3670018,3735553,3801089,3866625,3932161,3997697,4063233,4128769,4194305,4259841,4325377,4390913,4456449,4521989,4587525,4653057,4718593,4784129,4849665,4915201,4980737,5046273,5111809,5177345,5242881,5308417,5373954,5439493,5505025,5570561,5636097,5701633,5767169,5832705,5898241,5963777,6029313,6094849,6160385,6225921,6291461,6356993,6422529,6488065,6553601,6619137,6684673,6750209,6815745,6881281,6946817,7012353,7077889,7143425,7208961,7274497,7340033,7405569,7471105,7536641,7602177,7667713,7733249,7798785,7864322,7929857,7995393,8060929,8126465,8192001,8257537,8323073,8388609,8454145,8519681,8585217,8650753,8716289,8781825,8847361,8912897,8978433,9043969,9109505,9175041,9240577,9306113,9371649,9437185,9502721,9568257,9633793,9699329,9764865,9830401,9895937,9961473,10027009,10092545,10158081,10223617,10289153,10354689,10420225,10485761,10551297,10616833,10682369,10747905,10813441,10878977,10944513,11010053,11075585,11141121,11206657,11272193,11337733,11403265,11468801,11534337,11599873,11665409,11730945,11796481,11862017,11927553,11993089,12058629,12124161,12189697,12255237,12320769,12386305,12451842,12517377,12582913,12648449,12713985,12779521,12845057,12910593,12976133,13041665,13107201,13172737,13238273,13303809,13369345,13434881,13500417,13565953,13631489,13697025,13762561,13828102,13893633,13959173,14024705,14090241,14155781,14221313,14286849,14352385,14417921,14483457,14548993,14614529,14680065,14745601,14811137,14876673,14942209,15007746,15073281,15138817,15204353,15269889,15335425,15400961,15466497,15532033,15597569,15663105,15728641,15794177,15859713,15925249,15990785,16056321,16121857,16187393,16252929,16318465,16384001,16449537,16515073,16580613,16646145,16711681,16777218,16842753,16908289,16973825,17039361,17104897,17170433,17235969,17301505,17367041,17432581,17498113,17563649,17629185,17694721,17760257,17825793,17891329,17956865,18022401,18087937,18153473,18219009,18284545,18350081,18415618,18481153,18546693,18612225,18677761,18743301,18808833,18874369,18939909,19005441,19070977,19136513,19202049,19267585,19333121,19398657,19464193,19529729,19595265,19660801,19726337,19791873,19857409,19922945,19988481,20054021,20119553,20185089,20250625,20316161,20381701,20447233,20512769,20578305,20643841,20709377,20774913,20840449,20905989,20971521,21037057,21102593,21168129,21233665,21299201,21364737,21430273,21495809,21561345,21626881,21692417,21757955,21823489,21889025,21954561,22020097,22085633,22151169,22216705,22282245,22347777,22413313,22478849,22544385,22609921,22675457,22740993,22806529,22872070,22937601,23003137,23068673],"exists":[1376257,1900547,5373955,5439489,7077891,7536641,8126467,11010049,13959169,14286849,19660803,22872067],"expressionparser":[458754,786436,4718595,6553603,9109506,11206663,21626882],"enumeration":[5111809,17170433,18808833],"equal":[393217,655361,2752513,3145729,3342337,3866625,4718593,7012353,7340033,7471105,8585217,10420225,10485761,11206657,12189697,12713985,16121857,16908289,17039361,17760257,18284545,19595265,20447233,21102593],"enums":[3211265],"extensibilitypoint":[3473411,6225924,7405570,17039363,17629185,18284550]}
\ No newline at end of file
diff --git a/docs/fti/FTI_102.json b/docs/fti/FTI_102.json
deleted file mode 100644
index d5ed5a200..000000000
--- a/docs/fti/FTI_102.json
+++ /dev/null
@@ -1 +0,0 @@
-{"firstordefault":[2424835,3997699,8323076,13893635,15335429,21823491,23003140],"feature":[11141121,12779521,20185089],"filter":[1310722,1769473,6881281,12582913,14483457,16646146,17629185,19660801,21757953,22085634,22872065,23003137],"format":[720897,917505,1376257,1835010,2031617,2097153,2424833,3014657,3080193,3801089,4259841,4390913,4587521,4784129,4980737,5767169,6094849,6160385,6291457,6356993,6881281,6946817,7602177,8257537,8388609,8912897,10092545,10223617,10354689,10682369,10813441,11010049,11075585,11272193,11337729,11599873,11730945,12058625,12320769,12582913,13041665,13107201,13303809,13631490,13762561,13893633,13959169,14090241,14155777,14221313,14286849,15138817,15204353,15925250,16318465,16449537,16973825,17301505,17432577,17891329,18087937,18153473,18350081,18546689,18612225,18939905,19988481,20054017,20905985,21954562,22282241,22413313],"friendly":[655361,9699329,10420225,12189697,21102593],"finalize":[655361,2752513,3145729,3342337,4718593,7012353,7340033,7471105,8585217,10420225,10485761,11206657,12189697,12713985,16121857,16908289,17039361,18284545,19595265,21102593],"findtypesmarkedwithdynamiclinqtypeattribute":[655361,2555906,10420225,12189697,21102593],"function":[393217,655361,720897,917505,1179653,1376257,1835012,2031619,2097153,2424833,2752513,3014657,3145729,3342337,4259841,4390913,4587521,4718593,4784131,4980737,5767170,6094849,6160385,6291457,6356993,6946819,7012353,7340033,7471105,7602177,8257537,8323083,8388609,8585217,8912897,10092545,10223617,10354689,10420225,10485761,10682369,10813441,10878980,11010049,11075585,11206657,11272193,11337729,11599873,12058626,12189697,12320769,12713985,13107201,13303809,13631492,13762561,13893633,13959169,14090241,14155777,14221313,14286849,15138817,15204353,15925252,16121857,16318465,16449537,16908289,16973825,17039361,17301505,17432577,17760257,17891331,17956870,18087937,18153473,18284545,18350082,18546690,18939905,19595265,19922945,20054017,20905985,21102593,21233665,21954564,22282241,22413313,23003147],"fields":[3473410,18284545],"free":[655361,2752513,3145729,3342337,4718593,7012353,7340033,7471105,8585217,10420225,10485761,11206657,12189697,12713985,16121857,16908289,17039361,18284545,19595265,21102593],"fail":[1507329,5963777,7340033],"functionality":[3211266,5963777,7340033,9371649,12189697,17629186,18284545,22937601],"functions":[5177345,6815745,8060931,8323075,13828097,21757953,22544385,23003139],"follow":[1],"file":[393217,9306113],"firstordefaultasync":[720899,2097155,3670020,4587523,5373955,6160387,8126467,9764868,19660803,20381699,21889027,22872067],"finding":[5963777,7340033,9371649],"following":[262145,393217,655361,2293761,2752513,2949121,3145729,3342337,3473409,3866625,4128769,4718593,5111809,5963777,6553601,6750209,7012353,7340033,7471105,8323073,8585217,8978433,9306113,10027009,10420225,10485761,11141121,11206657,12189697,12713985,12779521,14352385,14548993,14614529,16121857,16908289,17039361,17629185,17760257,18284545,18808834,19464193,19595265,20447233,20578305,20971521,21102593,22937601,23003137],"first":[589825,720900,917505,1114113,1179649,1310721,1376257,1835009,1966081,2031621,2097156,2424836,2818052,2883585,3014658,3080193,3670019,3735553,3801089,3997700,4259841,4390914,4521985,4587524,4653057,4784132,4980737,5177345,5242881,5373958,5439489,5701633,5767169,5963778,6029313,6094849,6160388,6291457,6356994,6422529,6619137,6815745,6881281,6946821,7274497,7340034,7536641,7602177,7667713,7798785,8126470,8257537,8323084,8388609,8781833,8912897,9043969,9175041,9371649,9502722,9568258,9764867,9830401,9895937,9961474,10092546,10223617,10354689,10682369,10813441,10944513,11010049,11075585,11272194,11337729,11468801,11599873,11665409,11730945,11862017,11993089,12058625,12255233,12320770,12451843,12582913,12976129,13041665,13107202,13172737,13303809,13369345,13631489,13697025,13762562,13893636,13959169,14090241,14155777,14221314,14286849,14417921,14483457,14745601,14876673,15073287,15138817,15204353,15269889,15335428,15597569,15794183,15859713,15925249,16318465,16384001,16449543,16515073,16580612,16646145,16973831,17104898,17301508,17367041,17432580,17825793,17891332,18022401,18087938,18153473,18219009,18350081,18546689,18612225,18743297,18874369,18939905,19005441,19136513,19529729,19660806,19791873,19922945,19988481,20054017,20119553,20250625,20381700,20643841,20709377,20774913,20905988,21168129,21233665,21430273,21495809,21823492,21889028,21954561,22085633,22151171,22282241,22347777,22413316,22478849,22544385,22675457,22872070,23003148],"frames":[393217,9306113],"framework":[3211265,5963777,7340033,12189697,14811137],"false":[1507329,1638402,4194305,5963783,6094849,7340039,7602177,7995394,8257537,9371649,11796481,12386305,12976129,13697025,14155777,14811137,15204353,15269889,15990785,17825793,18939905,19791873,20185089,21692417],"factory":[12779521,17629185],"firstasync":[2818051,5373955,8126467,12451844,16580611,17301507,17432579,19660803,20905987,22151172,22413315,22872067],"filters":[851971,1310721,6881281,8323078,12582913,14483457,14680067,16646145,22085633,23003142],"form":[1441794,3801089,8323074,19988481,23003138],"field":[6553601,7405570,9109505,11206657],"formats":[720897,917505,1376257,1835010,2031617,2097153,2424833,3014657,3080193,3801089,4259841,4390913,4587521,4784129,4980737,5767169,6094849,6160385,6291457,6356993,6881281,6946817,7602177,8257537,8388609,8912897,10092545,10223617,10354689,10682369,10813441,11010049,11075585,11272193,11337729,11599873,11730945,12058625,12320769,12582913,13041665,13107201,13303809,13631490,13762561,13893633,13959169,14090241,14155777,14221313,14286849,15138817,15204353,15925250,16318465,16449537,16973825,17301505,17432577,17891329,18087937,18153473,18350081,18546689,18612225,18939905,19988481,20054017,20905985,21954562,22282241,22413313],"finds":[655361,2555905,10420225,12189697,21102593],"fullname":[6750209,10420225,10551297,12189697,14942209,22740993,22937601],"func":[7405570,8060929,8192011,8323073,8847363,13565955,16056323,19726347,21037066,22544387,23003137],"flag":[1507329,5963778,7340034,9371649]}
\ No newline at end of file
diff --git a/docs/fti/FTI_103.json b/docs/fti/FTI_103.json
deleted file mode 100644
index 4f4bc0738..000000000
--- a/docs/fti/FTI_103.json
+++ /dev/null
@@ -1 +0,0 @@
-{"github":[5963777,7340033,14811137],"getcustomtypes":[6750209,7733251,10420225,12189697,12648450,22937601],"getter":[17629185,18808833],"getassemblies":[2949121,16711682,19464193],"groupbymany":[5177347,6815747,7012353,8060932,8323075,17629185,22544387,23003139],"garbage":[655361,2752513,3145729,3342337,4718593,7012353,7340033,7471105,8585217,10420225,10485761,11206657,12189697,12713985,16121857,16908289,17039361,18284545,19595265,21102593],"gblog":[5963777,7340033,14811137],"groupjoin":[2031619,5898243,6946819,8323074,23003138],"generated":[983042,1769473,2686978,4915202,5636098,5963777,7340033,11141121,12779521,12910594,13238274,14811137,16187394,16842754,17629185,17694722,19660801,20185089,21364738,21757953,22609922,22872065,23003137],"general":[19857409],"group":[262148,917508,2621441,5177347,6815747,7012358,7471106,8060931,8323081,10354692,11599875,11927553,12124161,15138819,15400962,17956870,18677761,19922948,21233668,22544387,23003145],"groupresult":[262147,2621442,5177347,6815747,7012358,7471107,8716292,11927556,12124162,15400962,17629185,18677762,22544387],"gettype":[393217,655361,2752513,3145729,3342337,3866625,4718593,7012353,7340033,7471105,8585217,10420225,10485761,11206657,12189697,12713985,16121857,16908289,17039361,17760257,18284545,19595265,20447233,21102593],"gets":[393225,655362,1048577,2293762,2752513,2949121,3145729,3276801,3342337,3604481,3866625,4063233,4128769,4325377,4718593,4849665,5111810,5570562,5963781,6553601,7012353,7340038,7471105,8519681,8585217,8650753,9109505,9306120,9699329,10027009,10289153,10420226,10485766,11206658,12189698,12386305,12713985,14614533,16121857,16711681,16908294,17039361,17235969,17760257,18284545,18808835,19267585,19333121,19464193,19595267,19791873,20447234,20512769,20971525,21102594,22216705],"getassemblytypeswithdynamiclinqtypeattribute":[655361,9699330,10420225,12189697,21102593],"getobjectdata":[393218,5505028,17760258],"generate":[11141121,12779521,20185089],"generic":[524289,2555905,5177345,6815745,7274497,9699329,11862027,12517377,12713985,15597578,17367041,20185089,20971521,22544385],"getting":[1638401,5111809,18808833],"gethashcode":[393217,655361,2752513,3145729,3342337,3866625,4718593,7012353,7340033,7471105,8585217,10420225,10485761,11141121,11206657,12189697,12713985,12779521,16121857,16908289,17039361,17629185,17760257,18284545,18808833,19595265,20185089,20447233,21102593],"groupresult2":[917505,10354689,11599873,15138817,19922945,21233665],"graeme":[5963777,7340033,14811137],"getdynamicpropertyvalue":[5111810,5570563,18808834,19267587,19333123],"getdynamicmembernames":[5111809,17170434,18808833],"grouped":[2031617,6946817],"groups":[917505,2031617,5177345,5898242,6815745,6946817,8060931,8323083,10354689,11599873,15138817,17956870,19922945,21233665,22544385,23003147],"guide":[589825,720897,917505,1114113,1179649,1310721,1376257,1835009,1966081,2031617,2097153,2424833,2818049,2883585,3014657,3080193,3735553,3801089,3997697,4259841,4390913,4521985,4587521,4653057,4784129,4980737,5177345,5242881,5439489,5701633,5767169,6029313,6094849,6160385,6291457,6356993,6422529,6619137,6815745,6881281,6946817,7274497,7536641,7602177,7667713,7798785,8257537,8388609,8912897,9043969,9175041,9502721,9568257,9830401,9895937,9961473,10092545,10223617,10354689,10682369,10813441,10944513,11010049,11075585,11272193,11337729,11468801,11599873,11665409,11730945,11862017,11993089,12058625,12255233,12320769,12582913,12976129,13041665,13107201,13172737,13303809,13369345,13631489,13697025,13762561,13893633,13959169,14090241,14155777,14221313,14286849,14417921,14483457,14745601,14876673,15073281,15138817,15204353,15269889,15597569,15794177,15859713,15925249,16318465,16384001,16449537,16515073,16580609,16646145,16973825,17104897,17301505,17367041,17432577,17825793,17891329,18022401,18087937,18153473,18219009,18350081,18546689,18612225,18743297,18874369,18939905,19005441,19136513,19529729,19922945,19988481,20054017,20119553,20250625,20381697,20643841,20709377,20774913,20905985,21168129,21233665,21430273,21495809,21823489,21889025,21954561,22085633,22282241,22347777,22413313,22478849,22544385,22675457],"groupresult1":[917505,10354689,11599873,15138817,19922945,21233665],"getbaseexception":[393217,17760257],"given":[11141122,12779522,20185090],"groupby":[917509,5963778,7340034,8323078,10354693,11599877,15138821,17956871,19791874,19922949,21233669,23003142],"getmemberbinder":[1638402]}
\ No newline at end of file
diff --git a/docs/fti/FTI_104.json b/docs/fti/FTI_104.json
deleted file mode 100644
index 7cf2f33a8..000000000
--- a/docs/fti/FTI_104.json
+++ /dev/null
@@ -1 +0,0 @@
-{"helplink":[393217,9306113],"hash":[393217,655361,2752513,3145729,3342337,3866625,4718593,7012353,7340033,7471105,8585217,10420225,10485761,11206657,12189697,12713985,16121857,16908289,17039361,17760257,18284545,19595265,20447233,21102593],"helper":[13565953,17629185],"help":[393217,9306113],"https":[1572867,4259841,4521985,5373958,5701633,5963778,6291457,7340034,8126470,8388609,10813441,11075585,11337729,11993089,12255233,14811137,15007747,16777219,17498115,19660806,19791873,20054017,22282241,22872070],"http":[1441794,8323074,12779521,17629185,20709377,22347777,23003138],"holds":[5505025],"hresult":[393218,9306114],"hashset":[7733251,12648451],"handy":[1769473,17629185,19660801,21757953,22872065,23003137],"hierarchy":[393217,3342337,7012353,7208961,7340033,10485761,11206657,12189697,12779521,13565953,13828097,16908289,18284545,18808833,19595265,19660801,20447233,21102593,22806529,22872065,23003137],"higher":[5963777,7340033,14024705],"hill":[5963777,7340033,14811137],"happens":[1507329,5963777,7340033]}
\ No newline at end of file
diff --git a/docs/fti/FTI_105.json b/docs/fti/FTI_105.json
deleted file mode 100644
index 2dbd06b79..000000000
--- a/docs/fti/FTI_105.json
+++ /dev/null
@@ -1 +0,0 @@
-{"int32":[3276801,4063233,5767169,6029313,6422529,6619140,8323076,8650753,9043969,10682369,10747905,12058625,12124161,12845057,13303809,17235969,18219009,18350081,18546689,18743297,19005441,19202050,21168132,23003140,23068674],"iorderedqueryable":[589826,2162692,3080194,8323076,11730950,13041666,14417932,14876674,18612230,21495819,23003140],"invocations":[11141121,12779521,20185089],"initializers":[3473409,7405569,11141121,12779521,18284545,20185089],"int":[3276801,4063233,5767169,6029313,6422529,6619138,8650753,9043969,10682369,10747905,12058625,12124161,12845057,13303809,14548994,17235969,18219009,18350081,18546689,18743297,19005441,21168130,21626882],"immediate":[393217,9306113],"iassemblyhelper":[2949123,16711682,17629186,19464196],"ilist":[20185090],"ienumerable":[524290,1114118,2031619,2555909,2621442,4784131,5177352,5308417,5898242,6815752,6946819,7208967,7274502,7929860,8060931,8323082,9699333,9895941,10158086,10420226,10551297,11862029,11927554,12189698,12517378,13172742,15466502,15597580,15663110,15859718,16515078,17170434,17367046,17629186,17891331,19398662,22544392,22806535,23003146],"implement":[1769473,11141122,12779522,17629185,19660801,20185090,21757953,22872065,23003137],"interfaces":[2228225,3211265,17629185,21626881],"intermediate":[1835010,8323076,10878980,13631490,15925250,21954562,23003140],"itname":[6553601,9109506,11206657],"ignorecase":[1638401,7995393],"iqueryprovider":[15990787,21692418],"instead":[5963777,7340033,9371649],"invokes":[1835009,8323076,10878980,13631489,15925249,21954561,23003140],"identical":[11141121,12779521,20185089],"include":[8323073,21168129,23003137,23068673],"inheritance":[393217,3342337,7012353,7208961,7340033,10485761,11206657,12189697,12779521,13565953,13828097,16908289,18284545,18808833,19595265,19660801,20447233,21102593,22806529,22872065,23003137],"inspect":[524289,12517377],"implementation":[1638401,3211265,3342337,5111810,7995393,12189697,17629185,18808834],"inherited":[393228,655366,2752518,3145734,3342342,3866630,4718598,5308417,7012357,7340038,7471109,8585222,9306120,10027009,10420234,10485770,10551297,11206662,12189706,12713990,16121862,16908294,17039366,17760260,18284550,19595270,20447239,20971524,21102598],"iserializable":[5505025],"information":[393218,589825,720897,917505,1114113,1179649,1310721,1376257,1638401,1835009,1966081,2031617,2097153,2424833,2818049,2883585,3014657,3080193,3735553,3801089,3997697,4259841,4390913,4521985,4587521,4653057,4784129,4980737,5177345,5242881,5439489,5505026,5701633,5767169,6029313,6094849,6160385,6291457,6356993,6422529,6619137,6815745,6881281,6946817,7274497,7536641,7602177,7667713,7798785,7995393,8257537,8388609,8912897,9043969,9175041,9306113,9502721,9568257,9830401,9895937,9961473,10092545,10223617,10354689,10682369,10813441,10944513,11010049,11075585,11272193,11337729,11468801,11599873,11665409,11730945,11862017,11993089,12058625,12255233,12320769,12582913,12976129,13041665,13107201,13172737,13303809,13369345,13631489,13697025,13762561,13893633,13959169,14090241,14155777,14221313,14286849,14417921,14483457,14745601,14876673,15073281,15138817,15204353,15269889,15597569,15794177,15859713,15925249,16318465,16384001,16449537,16515073,16580609,16646145,16973825,17104897,17301505,17367041,17432577,17760257,17825793,17891329,18022401,18087937,18153473,18219009,18350081,18546689,18612225,18743297,18874369,18939905,19005441,19136513,19529729,19922945,19988481,20054017,20119553,20250625,20381697,20643841,20709377,20774913,20905985,21168129,21233665,21430273,21495809,21823489,21889025,21954561,22085633,22282241,22347777,22413313,22478849,22544385,22675457],"insert":[720897,917505,1376257,1835010,2031617,2097153,2424833,3014657,3080193,3801089,4259841,4390913,4587521,4784129,4980737,5767169,6094849,6160385,6291457,6356993,6881281,6946817,7602177,8257537,8388609,8912897,10092545,10223617,10354689,10682369,10813441,11010049,11075585,11272193,11337729,11599873,11730945,12058625,12320769,12582913,13041665,13107201,13303809,13631490,13762561,13893633,13959169,14090241,14155777,14221313,14286849,15138817,15204353,15925250,16318465,16449537,16973825,17301505,17432577,17891329,18087937,18153473,18350081,18546689,18612225,18939905,19988481,20054017,20709377,20905985,21954562,22282241,22347777,22413313],"inside":[5963777,7340033,20316161],"item":[4128769,4849665,18808833],"indicate":[3080193,11730945,13041665,18612225],"invoking":[1835009,3801089,4980737,8912897,10223617,13631489,15925249,16318465,19988481,20709377,21954561,22347777],"info":[5505026],"inner":[2031618,4784131,6946818,11862019,15597571,17891331],"income":[6094850,6356994,10092546,10682370,13303810,14090242,15204354,18153474],"input":[1114113,1376257,1835009,4980737,5439489,6029313,6422529,6881281,7274497,7536641,8323073,8912897,9895938,10223617,11010049,12582913,13172737,13631489,13959169,14090241,14286849,14483457,15859713,15925249,16318465,16515073,17367041,18153473,18219009,18743297,19529729,20774913,21954561,22478849,23003137],"instance":[196609,393219,589826,655361,720899,786433,917506,1114114,1179650,1245185,1310722,1376259,1638401,1703937,1835010,1966082,2031618,2097155,2424834,2752513,2818051,2883586,3014658,3080194,3145729,3342338,3538945,3735554,3801090,3866629,3932161,3997698,4259843,4390914,4521987,4587523,4653058,4718593,4784130,4980738,5177346,5242882,5439491,5701635,5767171,5832705,6029315,6094850,6160387,6225921,6291459,6356994,6422530,6619138,6815746,6881282,6946818,7012354,7274498,7340034,7471105,7536643,7602179,7667714,7798786,7995394,8257539,8388611,8585217,8716289,8912898,9043970,9175042,9306113,9437185,9502722,9568258,9830402,9895938,9961474,10092546,10223618,10354690,10420225,10485762,10682370,10747905,10813443,10944514,11010051,11075587,11141121,11206658,11272194,11337731,11468802,11599874,11665410,11730946,11862018,11993091,12058627,12189698,12255235,12320770,12582914,12713985,12779521,12976131,13041666,13107202,13172738,13303810,13369346,13631490,13697026,13762562,13893634,13959171,14090242,14155779,14221314,14286851,14417922,14483458,14745602,14876674,15073282,15138818,15204354,15269891,15400961,15597570,15794178,15859714,15925250,16121857,16318466,16384002,16449538,16515074,16580611,16646146,16908290,16973826,17039361,17104898,17301507,17367042,17432579,17563649,17760257,17825794,17891330,18022402,18087938,18153474,18219010,18284546,18350083,18546691,18612226,18743299,18808833,18874370,18939907,19005442,19136514,19529730,19595266,19922946,19988482,20054019,20119554,20185089,20250626,20381699,20447238,20643842,20709378,20774914,20905987,21102594,21168130,21233666,21430274,21495810,21561345,21823490,21889027,21954562,22085634,22282243,22347778,22413315,22478850,22544386,22675458],"innerkeyselector":[2031618,4784130,6946818,11862019,15597571,17891330],"items":[262145,2621442,7012354,7471105,15400961,17629185,18808833],"inherit":[11141121,12779521,20185089],"iqueryable":[131076,327682,589834,720901,851973,917512,1048578,1179653,1310728,1376261,1441798,1572867,1769473,1835016,1900547,1966085,2031623,2097157,2359300,2424837,2490372,2818053,2883594,3014661,3080197,3407875,3604482,3670019,3735561,3801095,3997701,4259845,4390917,4456451,4521989,4587525,4653068,4784135,4980744,5242892,5373973,5439493,5701637,5767173,5898242,6029317,6094853,6160389,6291461,6357000,6422534,6619144,6881288,6946823,7077891,7536645,7602181,7798795,7864323,7929860,8126485,8257541,8323172,8388613,8454150,8781828,8912904,9043973,9175051,9240580,9502725,9568261,9764867,9830407,9895939,9961477,10092552,10223624,10354696,10616834,10682374,10813445,10878994,10944515,11010053,11075589,11272197,11337733,11403268,11468809,11599880,11730945,11862031,11993093,12058629,12255237,12320773,12451843,12582920,12976133,13041669,13107205,13303814,13369355,13434882,13631496,13697028,13762565,13893637,13959173,14090248,14155781,14221317,14286853,14483464,14680070,14745612,14876681,15007747,15073285,15138824,15204357,15269893,15335428,15597582,15728644,15794181,15925256,15990787,16318472,16449541,16580613,16646152,16777219,16973829,17104901,17301509,17432581,17498115,17629185,17825797,17891335,17956870,18087941,18153480,18219015,18350085,18415619,18546693,18612225,18743301,18874377,18939909,19005446,19136521,19202050,19529733,19660822,19922952,19988487,20054021,20119563,20250629,20381701,20709383,20774917,20840452,20905989,21168133,21233672,21692418,21757953,21823493,21889029,21954568,22085640,22151171,22282245,22347783,22413317,22478854,22675465,22872086,23003237,23068674],"ittype":[5636098,12910594,16187394,21364738],"index":[1507330,5963778,7340034,18219009],"indicates":[3211265,3866627,20447236],"identifier":[10027009,20447233],"isdefaultattribute":[3866625,20447233],"inverts":[8323073,22478849,23003137],"implemented":[10027009,20447233],"iexpressionpromoter":[5963777,7340033,9633794,14548995,20578307,21626881,22216707],"initializes":[196609,393217,786433,1245185,1703937,3342337,3538945,3932161,5832705,6225921,7012353,7340033,8716289,9437185,10485761,10747905,11206657,12189697,16908289,17563649,18284545,18808833,19595265,20447233,21102593,21561345],"innerexception":[393217,9306113],"igrouping":[2228225,22020098],"idynamiclinkcustomtypeprovider":[3211266,5963777,6750211,7340033,7733249,10289155,12189698,12648450,14942210,15532034,18481153,22740993,22937603],"implements":[5505025,7733249,13500417,15990785,18481153,22740993],"iqueryableanalyzer":[3342338,5963777,7340033,8978435,14352387,15990785,17629185,20512771,21692418],"indicating":[5963778,7340034,12386305,19791873],"interface":[2228225,2949121,3211267,6750209,8978435,9633793,12648449,14352385,14548994,14942209,15532033,16711681,17629187,19464195,20578305,21626881,21692417,22020098,22937603]}
\ No newline at end of file
diff --git a/docs/fti/FTI_106.json b/docs/fti/FTI_106.json
deleted file mode 100644
index df4f58001..000000000
--- a/docs/fti/FTI_106.json
+++ /dev/null
@@ -1 +0,0 @@
-{"join":[2031621,4784136,6946821,7929861,8323076,11862029,15597580,17891336,23003140]}
\ No newline at end of file
diff --git a/docs/fti/FTI_107.json b/docs/fti/FTI_107.json
deleted file mode 100644
index 0f79709b9..000000000
--- a/docs/fti/FTI_107.json
+++ /dev/null
@@ -1 +0,0 @@
-{"keywords":[5963777,7340033,20316161],"keyselectors":[5177346,6815746,22544386],"know":[1769473,17629185,19660801,21757953,22872065,23003137],"keys":[2031618,4784130,5177345,5898244,6815745,6946818,7929860,8323080,17891330,22544385,23003144],"key":[262146,393217,917508,2031618,2162690,2228225,2490370,3080193,4784130,5177347,6815747,6946818,7012355,7471105,8060934,8323094,9306113,10354692,11599876,11730945,13041665,15138820,15400961,17891330,17956876,18612225,18677763,19922948,21233668,22020097,22544387,23003158],"keyword":[4194305,5963777,6553601,7340033,9109505,11206657],"keyselector":[917506,10354690,11599874,15138818,19922946,21233666]}
\ No newline at end of file
diff --git a/docs/fti/FTI_108.json b/docs/fti/FTI_108.json
deleted file mode 100644
index b47e73608..000000000
--- a/docs/fti/FTI_108.json
+++ /dev/null
@@ -1 +0,0 @@
-{"linear":[6356993,10092545],"lambdaexpression":[131073,851969,983044,2359297,2686980,3997699,4915204,5636100,8323081,8781825,8847371,9043971,9240577,9502723,9568259,9961475,11403265,12910596,13238276,13565964,13697027,14483460,15335425,15728641,15794179,16056331,16187396,16842756,17104899,17629185,17694724,20840449,21364740,22609924,23003145],"lastasync":[1572868,4521987,5373955,5701635,8126467,8388611,10813443,11337731,15007748,19660803,22282243,22872067],"lastordefault":[1966083,3014659,8323076,9961475,13762563,20840453,23003140],"lifetime":[11141121,12779521,20185089],"loaded":[2949121,16711681,17629185,19464194],"locate":[19070977],"long":[327682,6356993,8323076,10092545,13434882,14090241,18153473,23003140],"like":[3211266,5963777,7340033,9371649,21102593],"lastname":[11730945,18612225],"lambda":[3997699,9043971,9502723,9568259,9961475,13697027,14483459,15794179,17104899,22544385],"load":[19857409],"list":[131073,327681,851969,1441793,1572865,1900545,2162689,2359297,2490369,3407873,3670017,4456449,5308417,5570561,5898241,6684673,6750209,7077889,7667714,7733250,7864321,7929857,8060929,8454145,8781825,8847361,9240577,9764865,10158081,10420225,10551297,10616833,10878977,11403265,11534337,11665410,12189697,12451841,12648450,13434881,14680065,15007745,15335425,15663105,15728641,16384002,16777217,17498113,17956865,18022402,18415617,19202049,20643842,20840449,21299201,21430274,22151169,22937601,23068673],"lastordefaultasync":[4259843,5373955,6291459,8126467,11075587,11993091,12255235,16777220,17498116,19660803,20054019,22872067],"longer":[14090241,18153473,19070977],"linq":[65537,131074,196613,262146,327682,393223,458757,524293,589844,655362,720898,786439,851970,917511,983047,1048581,1114117,1179654,1245189,1310726,1376258,1441796,1507333,1572865,1638405,1703941,1769474,1835014,1900545,1966086,2031623,2097154,2162690,2228227,2293762,2359298,2424838,2490370,2555909,2621445,2686984,2752514,2818050,2883602,2949122,3014663,3080198,3145730,3211269,3276805,3342343,3407873,3473411,3538949,3604485,3670017,3735559,3801094,3866626,3932165,3997703,4063237,4128770,4194309,4259842,4325381,4390918,4456449,4521986,4587522,4653076,4718594,4784134,4849669,4915208,4980743,5046275,5111810,5177350,5242908,5308418,5373953,5439490,5505029,5570562,5636102,5701634,5767170,5832709,5898242,5963780,6029314,6094855,6160386,6225925,6291458,6356998,6422534,6488069,6553602,6619142,6684674,6750211,6815749,6881286,6946822,7012358,7077889,7143429,7208966,7274501,7340041,7405574,7471106,7536642,7602178,7667721,7733254,7798802,7864321,7929858,7995397,8060930,8126465,8192031,8257538,8323076,8388610,8454146,8519685,8585218,8650757,8716293,8781826,8847368,8912902,8978437,9043975,9109509,9175058,9240578,9306114,9371653,9437189,9502727,9568263,9633798,9699333,9764865,9830406,9895942,9961479,10027010,10092551,10158082,10223623,10289157,10354694,10420227,10485767,10551298,10616834,10682374,10747909,10813442,10878978,10944518,11010050,11075586,11141122,11206662,11272198,11337730,11403266,11468806,11534338,11599878,11665417,11730951,11796485,11862053,11927557,11993090,12058626,12124165,12189704,12255234,12320775,12386309,12451841,12517381,12582919,12648454,12713986,12779526,12845061,12910598,12976130,13041671,13107206,13172741,13238279,13303815,13369362,13434882,13500421,13565964,13631494,13697031,13762566,13828097,13893639,13959170,14024709,14090246,14155778,14221319,14286850,14352386,14417940,14483463,14548997,14614530,14680066,14745628,14811141,14876690,14942213,15007745,15073286,15138823,15204358,15269890,15335426,15400965,15466498,15532037,15597592,15663106,15728642,15794183,15859717,15925255,15990791,16056328,16121858,16187399,16252933,16318470,16384009,16449543,16515077,16580610,16646150,16711685,16777217,16842758,16908295,16973830,17039362,17104903,17170437,17235973,17301506,17367045,17432578,17498113,17563653,17629188,17694727,17760258,17825798,17891335,17956866,18022408,18087943,18153479,18219014,18284551,18350082,18415617,18481157,18546690,18612230,18677765,18743298,18808839,18874374,18939906,19005446,19070977,19136518,19202050,19267589,19333125,19398658,19464197,19529734,19595270,19660801,19726358,19791878,19857409,19922950,19988487,20054018,20119570,20185094,20250630,20316166,20381698,20447240,20512773,20578306,20643848,20709384,20774918,20840450,20905986,20971522,21037076,21102599,21168134,21233671,21299202,21364743,21430281,21495826,21561349,21626883,21692423,21757954,21823494,21889026,21954567,22020101,22085639,22151169,22216709,22282242,22347783,22413314,22478854,22544389,22609927,22675462,22740997,22806534,22872065,22937606,23003144,23068674],"link":[1,393217,3211265,9306113,12189697],"location":[393217,9306113,10747905,12845057],"looking":[19070977],"level":[5963777,7340033,19791873],"linqtoobjects":[3342337,8978433,14352385,15990785,16121857,21692417],"language":[1638401,7995394,17629185],"library":[1572867,4259841,4521985,5373958,5701633,6291457,8126470,8388609,10813441,11075585,11337729,11993089,12255233,15007747,16777219,17498115,19660806,20054017,22282241,22872070]}
\ No newline at end of file
diff --git a/docs/fti/FTI_109.json b/docs/fti/FTI_109.json
deleted file mode 100644
index db5a04065..000000000
--- a/docs/fti/FTI_109.json
+++ /dev/null
@@ -1 +0,0 @@
-{"modify":[17629185,18284545],"members":[262145,393217,655361,2293761,2752513,2949121,3145729,3342337,3473409,3866625,4128769,4718593,5111809,5963777,6553601,6750209,7012353,7340033,7471105,8323073,8585217,8978433,9306113,10027009,10420225,10485761,11141122,11206657,12189697,12713985,12779522,14352385,14548993,14614529,16121857,16908289,17039361,17760257,18284545,18808833,19464193,19595265,20185089,20447233,20578305,20971521,21102593,22937601,23003137],"main":[5636097,12910593,16187393,21364737],"memory":[11141122,12779522,20185090],"max":[1179649],"mkd":[5963777,7340033,14811137],"memberwiseclone":[655361,2752513,3145729,3342337,4718593,7012353,7340033,7471105,8585217,10420225,10485761,11206657,12189697,12713985,16121857,16908289,17039361,18284545,19595265,21102593],"multiple":[720897,1376257,2097153,2818049,4259841,4521985,4587521,5177345,5439489,5701633,5767169,6029313,6160385,6291457,6815745,7536641,7602177,8060931,8257537,8323075,8388609,10813441,11010049,11075585,11141121,11337729,11993089,12058625,12255233,12779521,12976129,13959169,14155777,14286849,15269889,16580609,17301505,17432577,18350081,18546689,18743297,18939905,20054017,20185089,20381697,20905985,21889025,22282241,22413313,22544385,23003139],"marked":[655361,2555905,3211265,10420225,12189698,21102593],"methods":[393217,589826,655362,720898,917506,1114114,1179650,1310722,1376258,1769473,1835010,1966082,2031618,2097154,2424834,2752514,2818050,2883586,2949122,3014658,3080194,3145730,3342337,3735554,3801090,3866626,3997698,4259842,4390914,4521986,4587522,4653058,4718594,4784130,4980738,5111810,5177346,5242882,5373954,5439490,5701634,5767170,5963777,6029314,6094850,6160386,6291458,6356994,6422530,6619138,6750210,6815746,6881282,6946818,7012353,7208961,7274498,7340034,7471106,7536642,7602178,7667714,7798786,8126466,8257538,8323074,8388610,8585218,8912898,8978433,9043970,9175042,9502722,9568258,9830402,9895938,9961474,10092546,10223618,10354690,10420226,10485761,10682370,10813442,10944514,11010050,11075586,11141123,11206657,11272194,11337730,11468802,11599874,11665410,11730946,11862018,11993090,12058626,12189697,12255234,12320770,12582914,12713986,12779522,12976130,13041666,13107202,13172738,13303810,13369346,13565953,13631490,13697026,13762562,13893634,13959170,14090242,14155778,14221314,14286850,14352386,14417922,14483458,14548993,14745602,14876674,15073282,15138818,15204354,15269890,15466498,15597570,15794178,15859714,15925250,16056322,16121858,16318466,16384002,16449538,16515074,16580610,16646146,16908289,16973826,17039362,17104898,17301506,17367042,17432578,17629186,17760258,17825794,17891330,18022402,18087938,18153474,18219010,18284545,18350082,18546690,18612226,18743298,18808834,18874370,18939906,19005442,19136514,19398658,19464193,19529730,19595265,19660802,19791873,19922946,19988482,20054018,20119554,20185089,20250626,20381698,20447233,20578306,20643842,20709378,20774914,20905986,21102593,21168130,21233666,21430274,21495810,21757953,21823490,21889026,21954562,22085634,22282242,22347778,22413314,22478850,22544386,22675458,22806529,22872066,22937601,23003138],"misspelled":[19070977],"min":[1179649],"match":[3866625,9633793,20447233],"make":[5963777,7340033,19791873],"master":[5963777,7340033,14811137],"message":[393219,9306114,10747908],"method":[131073,327681,393217,458753,524289,589829,720902,851969,917509,983041,1114117,1179653,1310725,1376263,1441793,1572865,1638404,1835013,1900548,1966085,2031621,2097158,2162689,2359298,2424837,2490369,2555905,2686977,2818054,2883589,3014661,3080197,3407873,3670017,3735557,3801093,3997701,4259846,4390917,4456449,4521990,4587526,4653061,4784133,4915201,4980741,5111810,5177349,5242885,5308417,5373955,5439495,5505025,5570561,5636097,5701638,5767174,5898241,6029318,6094853,6160390,6291462,6356997,6422533,6488065,6619141,6684673,6815749,6881285,6946821,7077892,7274501,7536647,7602182,7667717,7733249,7798789,7864321,7929857,7995395,8060929,8126467,8192001,8257542,8323073,8388614,8454145,8781825,8847361,8912901,9043973,9175045,9240577,9306113,9502725,9568261,9633793,9699329,9764865,9830405,9895941,9961477,10092549,10158081,10223621,10354693,10551297,10616833,10682373,10813446,10878977,10944517,11010055,11075590,11141122,11272197,11337734,11403265,11468805,11534337,11599877,11665413,11730949,11862021,11993094,12058630,12255238,12320773,12451841,12517377,12582917,12648449,12779522,12910593,12976134,13041669,13107205,13172741,13238273,13303813,13369349,13434881,13500417,13631493,13697029,13762565,13893637,13959175,14090245,14155782,14221317,14286855,14417925,14483461,14680065,14745605,14876677,14942209,15007745,15073285,15138821,15204357,15269894,15335425,15400961,15532033,15597573,15663105,15728641,15794181,15859717,15925253,15990785,16187393,16252929,16318469,16384005,16449541,16515077,16580614,16646149,16711681,16777217,16842753,16973829,17104901,17170433,17301510,17367045,17432582,17498113,17629187,17694721,17825797,17891333,17956865,18022405,18087941,18153477,18219013,18350086,18415617,18481153,18546694,18612229,18743302,18808837,18874373,18939910,19005445,19136517,19202049,19267585,19333121,19529733,19660803,19726337,19922949,19988485,20054022,20119557,20185091,20250629,20381702,20643845,20709381,20774918,20840449,20905990,21037057,21168133,21233669,21299201,21364737,21430277,21495813,21692417,21823493,21889030,21954565,22085637,22151169,22282246,22347781,22413318,22478853,22544389,22609921,22675461,22740993,22872067,23003137,23068673],"matching":[2031617,4784130,5963777,6946817,7340033,7929858,8323074,9371649,17891330,23003138],"mapping":[1835009,13631489,15925249,21954561],"missing":[589831,2228225,2883590,4653063,5242887,7667716,7798790,8192008,9175046,11665412,11862026,13369350,14417927,14745607,14876678,15597577,16384004,18022403,19726344,20119558,20643843,21037063,21430276,21495814,21626881],"member":[1179650,1507331,1638403,5111811,5963779,7340035,7995396,17170434,18808835],"mydatabase":[5963777,7340033,9371649],"maybe":[1572867,4259841,4521985,5373958,5701633,6291457,8126470,8388609,10813441,11075585,11337729,11993089,12255233,15007747,16777219,17498115,19660806,20054017,22282241,22872070],"microsoft":[65537,131073,196609,262145,327681,393217,458753,524289,589825,655361,720897,786433,851969,917505,983041,1048577,1114113,1179649,1245185,1310721,1376257,1441793,1507329,1572868,1638401,1703937,1769473,1835009,1900546,1966081,2031617,2097157,2162689,2228225,2293761,2359297,2424833,2490369,2555905,2621441,2686977,2752513,2818049,2883585,2949121,3014657,3080193,3145729,3211265,3276801,3342337,3407873,3473409,3538945,3604481,3670018,3735553,3801089,3866625,3932161,3997697,4063233,4128769,4194305,4259842,4325377,4390913,4456449,4521990,4587525,4653057,4718593,4784129,4849665,4915201,4980737,5046273,5111809,5177345,5242881,5308417,5373960,5439493,5505025,5570561,5636097,5701634,5767169,5832705,5898241,5963778,6029313,6094849,6160385,6225921,6291462,6356993,6422529,6488065,6553601,6619137,6684673,6750209,6815745,6881281,6946817,7012353,7077889,7143425,7208961,7274497,7340034,7405569,7471105,7536641,7602177,7667713,7733249,7798785,7864322,7929857,7995393,8060929,8126471,8192001,8257537,8323073,8388610,8454145,8519681,8585217,8650753,8716289,8781825,8847361,8912897,8978433,9043969,9109505,9175041,9240577,9306113,9371649,9437185,9502721,9568257,9633793,9699329,9764865,9830401,9895937,9961473,10027009,10092545,10158081,10223617,10289153,10354689,10420225,10485761,10551297,10616833,10682369,10747905,10813442,10878977,10944513,11010053,11075586,11141121,11206657,11272193,11337734,11403265,11468801,11534337,11599873,11665409,11730945,11796481,11862017,11927553,11993090,12058629,12124161,12189697,12255238,12320769,12386305,12451842,12517377,12582913,12648449,12713985,12779521,12845057,12910593,12976133,13041665,13107201,13172737,13238273,13303809,13369345,13434881,13500417,13565953,13631489,13697025,13762561,13828102,13893633,13959173,14024705,14090241,14155781,14221313,14286849,14352385,14417921,14483457,14548993,14614529,14680065,14745601,14811137,14876673,14942209,15007749,15073281,15138817,15204353,15269889,15335425,15400961,15466497,15532033,15597569,15663105,15728641,15794177,15859713,15925249,15990785,16056321,16121857,16187393,16252929,16318465,16384001,16449537,16515073,16580613,16646145,16711681,16777221,16842753,16908289,16973825,17039361,17104897,17170433,17235969,17301505,17367041,17432581,17498116,17563649,17629186,17694721,17760257,17825793,17891329,17956865,18022401,18087937,18153473,18219009,18284545,18350081,18415618,18481153,18546693,18612225,18677761,18743301,18808833,18874369,18939909,19005441,19070977,19136513,19202049,19267585,19333121,19398657,19464193,19529729,19595265,19660807,19726337,19791874,19857409,19922945,19988481,20054022,20119553,20185089,20250625,20316161,20381701,20447233,20512769,20578305,20643841,20709377,20774913,20840449,20905989,20971521,21037057,21102593,21168129,21233665,21299201,21364737,21430273,21495809,21561345,21626881,21692417,21757955,21823489,21889025,21954561,22020097,22085633,22151169,22216705,22282246,22347777,22413313,22478849,22544385,22609921,22675457,22740993,22806529,22872076,22937601,23003137,23068673],"msdn":[1572867,4259841,4521985,5373958,5701633,6291457,8126470,8388609,10813441,11075585,11337729,11993089,12255233,15007747,16777219,17498115,19660806,20054017,22282241,22872070]}
\ No newline at end of file
diff --git a/docs/fti/FTI_110.json b/docs/fti/FTI_110.json
deleted file mode 100644
index 72195a835..000000000
--- a/docs/fti/FTI_110.json
+++ /dev/null
@@ -1 +0,0 @@
-{"numeric":[8323073,10944514,23003137],"number":[262145,3407875,5373955,5767170,6029314,6422530,6619137,7012354,7471105,7864323,8126467,8323078,9043970,10682370,12058626,12124161,13303810,15400961,15728644,18219010,18350082,18546690,18743298,19005443,19660803,21168129,22872067,23003142],"names":[1769473,5111809,5963777,7340033,11141122,12779522,14811137,15925249,17170434,17629185,18808833,19660801,20185090,21757953,22872065,23003137],"needs":[5963777,7340033,9371649,20185089],"numberpropertyaskey":[917506,10354690,11599874,15138818,19922946,21233666],"nuget":[3473409,7405569,18284545],"newly":[11141121,12779521,20185089],"new":[196609,393217,786433,917506,1245185,1441796,1703937,3342337,3538945,3801090,3932161,4194305,5832705,5963778,6225921,7012353,7340035,8323076,8716289,9437185,10354690,10485761,10747905,11141121,11206657,11599873,12189697,12779521,15138817,16908289,17563649,18284545,18808833,19595265,19791873,19922946,19988482,20185093,20447233,20709378,21102593,21233666,21561345,22347778,22675457,23003140],"net":[1441794,3211267,8323074,12189698,17629186,20709377,21102593,22347777,23003138],"null":[524289,1835009,2818049,4521985,5439489,5701633,6029313,6881281,7536641,7602177,11993089,12255233,12517377,12582913,12976129,13631489,14155777,14942209,15269889,15532033,15925249,15990786,16580609,18481153,18743297,20381697,21692418,21889025,21954561,22740993],"numerical":[393217,9306113],"namespace":[131073,196610,262145,327681,393218,458754,524290,589826,655361,720898,786434,851969,917506,983042,1048578,1114114,1179650,1245186,1310722,1376258,1441793,1507330,1572865,1638402,1703938,1769473,1835010,1900545,1966082,2031618,2097154,2162689,2228225,2293761,2359297,2424834,2490369,2555906,2621442,2686978,2752513,2818050,2883586,2949121,3014658,3080194,3145729,3211265,3276802,3342338,3407873,3473409,3538946,3604482,3670017,3735554,3801090,3866625,3932162,3997698,4063234,4128769,4194306,4259842,4325378,4390914,4456449,4521986,4587522,4653058,4718593,4784130,4849666,4915202,4980738,5046273,5111809,5177346,5242882,5308417,5373953,5439490,5505026,5570561,5636098,5701634,5767170,5832706,5898241,5963777,6029314,6094850,6160386,6225922,6291458,6356994,6422530,6488066,6553601,6619138,6684673,6750209,6815746,6881282,6946818,7012354,7077889,7143426,7208962,7274498,7340034,7405570,7471105,7536642,7602178,7667714,7733250,7798786,7864321,7929857,7995394,8060929,8126465,8192002,8257538,8323073,8388610,8454145,8519682,8585217,8650754,8716290,8781825,8847361,8912898,8978434,9043970,9109506,9175042,9240577,9306113,9371650,9437186,9502722,9568258,9633794,9699330,9764865,9830402,9895938,9961474,10027009,10092546,10158081,10223618,10289154,10354690,10420225,10485762,10551297,10616833,10682370,10747906,10813442,10878977,10944514,11010050,11075586,11141121,11206658,11272194,11337730,11403265,11468802,11534337,11599874,11665410,11730946,11796482,11862018,11927554,11993090,12058626,12124162,12189698,12255234,12320770,12386306,12451841,12517378,12582914,12648450,12713985,12779522,12845058,12910594,12976130,13041666,13107202,13172738,13238274,13303810,13369346,13434881,13500418,13565954,13631490,13697026,13762562,13828098,13893634,13959170,14024706,14090242,14155778,14221314,14286850,14352385,14417922,14483458,14548994,14614529,14680065,14745602,14811138,14876674,14942210,15007745,15073282,15138818,15204354,15269890,15335425,15400962,15466497,15532034,15597570,15663105,15728641,15794178,15859714,15925250,15990786,16056321,16121857,16187394,16252930,16318466,16384002,16449538,16515074,16580610,16646146,16711682,16777217,16842754,16908290,16973826,17039361,17104898,17170434,17235970,17301506,17367042,17432578,17498113,17563650,17629185,17694722,17760257,17825794,17891330,17956865,18022402,18087938,18153474,18219010,18284546,18350082,18415617,18481154,18546690,18612226,18677762,18743298,18808834,18874370,18939906,19005442,19136514,19202049,19267586,19333122,19398657,19464194,19529730,19595266,19660802,19726338,19791874,19922946,19988482,20054018,20119554,20185090,20250626,20316162,20381698,20447234,20512770,20578305,20643842,20709378,20774914,20840449,20905986,20971521,21037058,21102594,21168130,21233666,21299201,21364738,21430274,21495810,21561346,21626881,21692418,21757953,21823490,21889026,21954562,22020098,22085634,22151169,22216706,22282242,22347778,22413314,22478850,22544386,22609922,22675458,22740994,22806530,22872066,22937602,23003138,23068673],"numberproperty":[3080195,6881282,11730947,12582914,13041667,18612227]}
\ No newline at end of file
diff --git a/docs/fti/FTI_111.json b/docs/fti/FTI_111.json
deleted file mode 100644
index 20e0b0524..000000000
--- a/docs/fti/FTI_111.json
+++ /dev/null
@@ -1 +0,0 @@
-{"omit":[589825,720897,917505,1114113,1179649,1310721,1376257,1835009,1966081,2031617,2097153,2424833,2818049,2883585,3014657,3080193,3735553,3801089,3997697,4259841,4390913,4521985,4587521,4653057,4784129,4980737,5177345,5242881,5439489,5701633,5767169,6029313,6094849,6160385,6291457,6356993,6422529,6619137,6815745,6881281,6946817,7274497,7536641,7602177,7667713,7798785,8257537,8388609,8912897,9043969,9175041,9502721,9568257,9830401,9895937,9961473,10092545,10223617,10354689,10682369,10813441,10944513,11010049,11075585,11272193,11337729,11468801,11599873,11665409,11730945,11862017,11993089,12058625,12255233,12320769,12582913,12976129,13041665,13107201,13172737,13303809,13369345,13631489,13697025,13762561,13893633,13959169,14090241,14155777,14221313,14286849,14417921,14483457,14745601,14876673,15073281,15138817,15204353,15269889,15597569,15794177,15859713,15925249,16318465,16384001,16449537,16515073,16580609,16646145,16973825,17104897,17301505,17367041,17432577,17825793,17891329,18022401,18087937,18153473,18219009,18350081,18546689,18612225,18743297,18874369,18939905,19005441,19136513,19529729,19922945,19988481,20054017,20119553,20250625,20381697,20643841,20709377,20774913,20905985,21168129,21233665,21430273,21495809,21823489,21889025,21954561,22085633,22282241,22347777,22413313,22478849,22544385,22675457],"one":[393217,1376257,1835010,1900547,2359300,4390913,4980738,5373955,5439489,7077891,7536641,8126467,8323088,8912898,9568257,10223618,10878984,11010049,11272193,11403268,12320769,13631490,13959169,14286849,15925250,16318466,17104897,17760257,18087937,19529729,19660803,20774913,21954562,22872067,23003152],"optimize":[3473409,7405569,18284545],"ordering":[589827,2162690,3080195,8323074,11730948,13041667,14417923,14876675,18612228,21495811,23003138],"orderby":[589834,2490373,3080198,8323076,11730948,13041670,14876681,18612228,23003140],"outer":[2031618,4784130,6946818,11862019,15597571,17891330],"objects":[720897,917505,983041,1114113,1376257,1835010,2031617,2097153,2228225,2424833,2686977,3014657,3080193,3801089,4259841,4390913,4587521,4784129,4915201,4980737,5636097,5767169,6094849,6160385,6291457,6356993,6881281,6946817,7208963,7274497,7602177,8257537,8388609,8912897,10092545,10158083,10223617,10354689,10682369,10813441,11010049,11075585,11272193,11337729,11599873,11730945,12058625,12320769,12582913,12910593,13041665,13107201,13172737,13238273,13303809,13631490,13762561,13893633,13959169,14090241,14155777,14221313,14286849,15138817,15204353,15466499,15663107,15859713,15925250,16187393,16318465,16449537,16515073,16842753,16973825,17301505,17367041,17432577,17629185,17694721,17891329,18087937,18153473,18350081,18546689,18612225,18808833,18939905,19398659,19988481,20054017,20185089,20709377,20905985,21364737,21954562,22020097,22282241,22347777,22413313,22609921,22806531],"overload":[131073,327681,589825,720897,851969,917505,983041,1114113,1310721,1376257,1441793,1572865,1835009,1900545,1966081,2031617,2097153,2162689,2359297,2424833,2490369,2686977,2818049,2883585,3014657,3080193,3407873,3670017,3735553,3801089,3997697,4259841,4390913,4456449,4521985,4587521,4653057,4784129,4915201,4980737,5177345,5242881,5308417,5439489,5570561,5636097,5701633,5767169,5898241,6029313,6094849,6160385,6291457,6356993,6422529,6488065,6619137,6684673,6815745,6881281,6946817,7012353,7077889,7274497,7536641,7602177,7667713,7798785,7864321,7929857,8060929,8192001,8257537,8388609,8454145,8781825,8847361,8912897,9043969,9175041,9240577,9502721,9568257,9764865,9961473,10092545,10158081,10223617,10354689,10551297,10616833,10682369,10813441,10878977,11010049,11075585,11272193,11337729,11403265,11468801,11534337,11599873,11665409,11730945,11862017,11993089,12058625,12255233,12320769,12451841,12582913,12910593,12976129,13041665,13107201,13172737,13238273,13303809,13369345,13434881,13631489,13697025,13762561,13893633,13959169,14090241,14155777,14221313,14286849,14417921,14483457,14680065,14745601,14876673,15007745,15073281,15138817,15204353,15269889,15335425,15597569,15663105,15728641,15794177,15859713,15925249,16187393,16252929,16318465,16384001,16449537,16515073,16580609,16646145,16777217,16842753,16973825,17104897,17301505,17367041,17432577,17498113,17629185,17694721,17825793,17891329,17956865,18022401,18087937,18153473,18350081,18415617,18481153,18546689,18612225,18743297,18874369,18939905,19136513,19202049,19267585,19333121,19529729,19726337,19922945,19988481,20054017,20119553,20250625,20381697,20643841,20709377,20774913,20840449,20905985,21037057,21168129,21233665,21299201,21364737,21430273,21495809,21823489,21889025,21954561,22085633,22151169,22282241,22347777,22413313,22544385,22609921,22675457,22740993,23068673],"observe":[1376257,2818049,4521985,4587521,5439489,5701633,6029313,6160385,6291457,7536641,7602177,8388609,11075585,11993089,12255233,12976129,13959169,14155777,15269889,16580609,17301505,17432577,18350081,18546689,18743297,20381697,21889025,22282241],"occurring":[14090241,18153473],"optional":[458753,1835009,2818049,3932161,4521985,5439489,5701633,6029313,7536641,7602177,11993089,12255233,12976129,13631489,14155777,15269889,15925249,15990785,16580609,18743297,20185089,20381697,21692417,21889025,21954561],"overridden":[393218,3866626,5505025,17760258,20447234],"object":[131074,327682,393222,589825,655371,720903,786434,851970,917509,983044,1114115,1179651,1310721,1376263,1441796,1572866,1638403,1835017,1900546,1966083,2031621,2097159,2162690,2359298,2424839,2490370,2686980,2752523,2818051,2883585,3014663,3080197,3145739,3342348,3407874,3670018,3735553,3801093,3866629,3997699,4128769,4259847,4390919,4456450,4521987,4587527,4653057,4718603,4784133,4849669,4915204,4980741,5111809,5177345,5242881,5373966,5439491,5505025,5636100,5701635,5767173,5898242,5963777,6029313,6094853,6160391,6291463,6356997,6422529,6619137,6684673,6815745,6881285,6946821,7012363,7077890,7208962,7274497,7340045,7471114,7536643,7602181,7667720,7798785,7864322,7929858,7995395,8060929,8126478,8257541,8323124,8388615,8585227,8781826,8847371,8912901,9043969,9175041,9240578,9306113,9502723,9568259,9764866,9830401,9895939,9961475,10092549,10223621,10354693,10420235,10485772,10616833,10682373,10813447,10878988,10944515,11010055,11075591,11141123,11206668,11272199,11337735,11403266,11468801,11534337,11599877,11665409,11730949,11862017,11993091,12058629,12189708,12255235,12320775,12386305,12451842,12582917,12713995,12779525,12910596,12976129,13041669,13107207,13172739,13238276,13303813,13369345,13434882,13565964,13631497,13697025,13762567,13828097,13893639,13959175,14090245,14155781,14221319,14286855,14417921,14483457,14548993,14745601,14876673,15007746,15073283,15138821,15204357,15269889,15335426,15466497,15597569,15728642,15794179,15859715,15925257,16056331,16121867,16187396,16252931,16318469,16384008,16449543,16515075,16580611,16646145,16777218,16842756,16908300,16973831,17039371,17104899,17301511,17367041,17432583,17498114,17629185,17694724,17760260,17825793,17891333,17956868,18022401,18087943,18153477,18219009,18284556,18350085,18415618,18546693,18612229,18677762,18743297,18808834,18874369,18939909,19005441,19136513,19267586,19398657,19529731,19595276,19660815,19922945,19988485,20054023,20119553,20185091,20250627,20381699,20447238,20643841,20709381,20774915,20840450,20905991,21102604,21168129,21233665,21299201,21364740,21430273,21495809,21626881,21823491,21889027,21954569,22085633,22151170,22282247,22347781,22413319,22478849,22544388,22609924,22675460,22806530,22872079,23003189],"outerkeyselector":[2031618,4784130,6946818,11862019,15597571,17891330],"occurred":[19857409],"order":[2162690,2490370,3080195,8323077,11730947,13041667,18612227,22478850,23003141],"overrides":[393218,7012353,7471105,17760258],"occur":[393217,5046273,18219009],"override":[1638401,5111810,5505025,7995393,11141121,12779521,13500417,15400961,17629185,18284545,18808834,20185089],"oftype":[1310723,8323075,14680068,16646147,22085635,23003139],"otherstringpropertyname":[3801089,19988481],"obtained":[2031617,4784129,6946817,17891329],"operations":[655361,720898,1376258,1638402,2097154,2752513,2818050,3145729,3342337,4259842,4521986,4587522,4718593,5111812,5439490,5701634,5767170,6029314,6160386,6291458,7012353,7340033,7471105,7536642,7602178,7995394,8257538,8388610,8585217,10420225,10485761,10813442,11010050,11075586,11206657,11337730,11993090,12058626,12189697,12255234,12713985,12976130,13959170,14155778,14286850,15269890,16121857,16580610,16908289,17039361,17301506,17432578,18284545,18350082,18546690,18743298,18808836,18939906,19595265,20054018,20381698,20905986,21102593,21889026,22282242,22413314],"optimizer":[3473409,7405569,18284545],"operation":[720897,1376257,1638404,2097153,2818049,4259841,4521985,4587521,5439489,5701633,5767169,6029313,6160385,6291457,7536641,7602177,7995394,8257537,8388609,10813441,11010049,11075585,11337729,11993089,12058625,12255233,12976129,13959169,14155777,14286849,15269889,16580609,17301505,17432577,18350081,18546689,18743297,18939905,20054017,20381697,20905985,21889025,22282241,22413313]}
\ No newline at end of file
diff --git a/docs/fti/FTI_112.json b/docs/fti/FTI_112.json
deleted file mode 100644
index c7e2ccaa1..000000000
--- a/docs/fti/FTI_112.json
+++ /dev/null
@@ -1 +0,0 @@
-{"process":[2555905,9699329],"parameters":[458753,524289,589826,720898,786436,917506,983044,1114113,1179649,1310721,1376258,1638401,1835011,1966081,2031618,2097154,2424834,2555905,2686980,2818049,2883586,3014658,3080194,3538945,3735553,3801090,3932161,3997697,4259842,4390914,4521985,4587522,4653058,4784130,4849665,4915204,4980738,5177346,5242882,5439489,5505025,5636098,5701633,5767170,6029313,6094850,6160386,6291458,6356994,6422529,6488066,6619137,6815746,6881282,6946818,7274498,7536641,7602178,7667713,7798786,7995393,8192005,8257538,8388610,8847366,8912898,9043969,9175042,9502721,9568257,9633793,9699329,9830401,9895937,9961473,10092546,10223618,10354690,10485761,10682370,10747905,10813442,10944513,11010050,11075586,11272194,11337730,11468801,11599874,11665410,11730946,11862018,11993089,12058626,12255233,12320770,12517377,12582914,12910594,12976129,13041666,13107202,13172737,13238274,13303810,13369346,13565958,13631491,13697025,13762562,13893634,13959170,14090242,14155778,14221314,14286850,14417922,14483457,14745602,14876674,14942209,15073281,15138818,15204354,15269889,15532033,15597570,15794177,15859713,15925251,15990785,16056326,16187394,16252929,16318466,16384001,16449538,16515073,16580609,16646145,16842754,16973826,17104897,17301506,17367042,17432578,17629185,17694724,17825793,17891330,18022401,18087938,18153474,18219009,18350082,18481153,18546690,18612226,18743297,18808833,18874369,18939906,19005441,19136513,19267585,19333122,19529729,19726338,19922945,19988482,20054018,20119554,20185090,20250625,20381697,20643841,20709378,20774913,20905986,21037058,21168129,21233665,21364738,21430274,21495810,21692417,21823489,21889025,21954563,22085633,22282242,22347778,22413314,22478849,22544386,22609922,22675457,22740993],"project":[1835009,3801089,4980737,8912897,10223617,13631489,15925249,16318465,19988481,20709377,21954561,22347777],"produced":[393217,9306113,10747905,12845057],"parameterization":[5963777,7340033,14811137],"place":[3473409,7405569,18284545],"providing":[3211266,22937601],"pagecount":[3276802,8323073,10485761,14614529,16908289,20971521,21168129,23003137,23068673],"persists":[19857409],"protected":[196609,524289,2555905,5832705,9699329,12517377],"parselambda":[983043,2686979,4915203,5636099,8192011,8847375,12910595,13238275,13565966,16056334,16187395,16842755,17694723,19726347,21037066,21364739,22609923],"parses":[983041,2686977,4915201,5636097,8847371,12910593,13238273,13565963,16056331,16187393,16842753,17694721,21364737,22609921],"passes":[720898,2097154,2424834,3014657,3997698,4259842,4390913,4587522,6160386,6291458,8388609,9502721,9568257,9961473,10813441,11075586,11272193,11337729,12320769,13107201,13762561,13893634,14090241,14221313,15794177,16449537,16973825,17104897,17301505,17432577,18087937,18153473,20054018,20905985,22282241,22413313],"public":[393217,458753,589825,720897,786433,917505,983041,1048577,1114113,1179649,1245185,1310721,1376257,1507329,1638401,1703937,1835009,1966081,2031617,2097153,2424833,2621441,2686977,2818049,2883585,3014657,3080193,3276801,3342337,3538945,3604481,3735553,3801089,3932161,3997697,4063233,4194305,4259841,4325377,4390913,4521985,4587521,4653057,4784129,4849665,4915201,4980737,5177345,5242881,5439489,5505025,5636097,5701633,5767169,6029313,6094849,6160385,6225921,6291457,6356993,6422529,6488065,6619137,6815745,6881281,6946817,7012353,7143425,7208961,7274497,7340033,7405569,7536641,7602177,7667713,7733249,7798785,7995393,8192001,8257537,8388609,8519681,8650753,8716289,8912897,8978433,9043969,9109505,9175041,9371649,9437185,9502721,9568257,9830401,9895937,9961473,10092545,10223617,10289153,10354689,10485761,10682369,10747905,10813441,10944513,11010049,11075585,11141121,11206657,11272193,11337729,11468801,11599873,11665409,11730945,11796481,11862017,11927553,11993089,12058625,12124161,12189697,12255233,12320769,12386305,12582913,12779522,12845057,12910593,12976129,13041665,13107201,13172737,13238273,13303809,13369345,13500417,13565953,13631489,13697025,13762561,13828097,13893633,13959169,14024705,14090241,14155777,14221313,14286849,14417921,14483457,14548993,14745601,14811137,14876673,15073281,15138817,15204353,15269889,15400961,15597569,15794177,15859713,15925249,15990785,16187393,16252929,16318465,16384001,16449537,16515073,16580609,16646145,16842753,16908289,16973825,17104897,17170433,17235969,17301505,17367041,17432577,17563649,17694721,17825793,17891329,18022401,18087937,18153473,18219009,18284545,18350081,18481153,18546689,18612225,18677761,18743297,18808833,18874369,18939905,19005441,19136513,19267585,19333121,19464193,19529729,19595265,19660801,19726337,19791873,19922945,19988481,20054017,20119553,20185090,20250625,20316161,20381697,20447233,20512769,20643841,20709377,20774913,20905985,21037057,21102593,21168129,21233665,21364737,21430273,21495809,21561345,21823489,21889025,21954561,22020097,22085633,22216705,22282241,22347777,22413313,22478849,22544385,22609921,22675457,22740993,22806529,22872065,22937601,23003137],"promoted":[9633793],"position":[393218,9306113,10747907,12845058],"paged":[6619138,8323074,19202049,21168129,23003138,23068673],"programming":[589825,720897,917505,1114113,1179649,1310721,1376257,1835009,1966081,2031617,2097153,2424833,2818049,2883585,3014657,3080193,3735553,3801089,3997697,4259841,4390913,4521985,4587521,4653057,4784129,4980737,5177345,5242881,5439489,5701633,5767169,6029313,6094849,6160385,6291457,6356993,6422529,6619137,6815745,6881281,6946817,7274497,7536641,7602177,7667713,7798785,8257537,8388609,8912897,9043969,9175041,9502721,9568257,9830401,9895937,9961473,10092545,10223617,10354689,10682369,10813441,10944513,11010049,11075585,11272193,11337729,11468801,11599873,11665409,11730945,11862017,11993089,12058625,12255233,12320769,12582913,12976129,13041665,13107201,13172737,13303809,13369345,13631489,13697025,13762561,13893633,13959169,14090241,14155777,14221313,14286849,14417921,14483457,14745601,14876673,15073281,15138817,15204353,15269889,15597569,15794177,15859713,15925249,16318465,16384001,16449537,16515073,16580609,16646145,16973825,17104897,17301505,17367041,17432577,17825793,17891329,18022401,18087937,18153473,18219009,18350081,18546689,18612225,18743297,18874369,18939905,19005441,19136513,19529729,19922945,19988481,20054017,20119553,20250625,20381697,20643841,20709377,20774913,20905985,21168129,21233665,21430273,21495809,21823489,21889025,21954561,22085633,22282241,22347777,22413313,22478849,22544385,22675457],"pagedresult":[1048578,2883586,3145731,3276802,3604482,4063234,8650754,9437188,10485773,12713987,14614531,16908296,17235970,17629188,20971527,21168131,21561348],"parsing":[393217,786433,1507330,2686977,4915201,5046273,5963778,7340034,13238273,16187393,21364737,22609921],"properties":[262146,393217,2293762,4128770,5963778,6553602,7012353,7340033,9306114,10027010,10485761,11141123,11206657,12779524,14614530,16908289,17629187,18808835,19595265,20185093,20447233,20971522],"paramete":[8323074,10616834,19136513,22675457,23003138],"parsed":[393217,1507329,5963777,7340033,9306113,10747905,12845057],"parameterized":[5963777,7340033,14811137],"parseexception":[393223,5046273,5505026,9306116,10747909,12845059,13500418,17760259],"performs":[2162690,8323074,11730945,18612225,23003138],"permission":[4980737,8912897],"propertyname":[6488066,16252930,19267586,19333122],"program":[3473409,7405569,18284545],"port":[17629185],"parameterexpressions":[983041,2686977,4915201,17694721],"point":[17629185,18284545],"parsingconfig":[131073,327681,786436,851969,917508,1441795,1507330,1703940,2031620,2162689,2359297,2490369,2686981,2752515,3014660,3735556,4194306,4915205,4980740,5177348,5242890,5898241,5963782,6094852,7143429,7340041,7929858,8060929,8192014,8323102,8454145,8781825,8847369,9240577,9371650,10092548,10223620,10289154,10878981,11403265,11730948,11796482,11862029,12320772,12386306,12582916,13041668,13238277,13303812,13434881,13565961,13893636,14024709,14221316,14680065,14745610,14811138,15138820,15335425,15728641,15925252,16056329,16187397,16449540,17629185,17891332,17956867,18087940,18153476,19726350,19791875,19988484,20316162,20512770,20709380,20840449,21037069,21233668,21364741,21954564,22085636,22216706,22609925,23003166],"perform":[655361,2752513,3145729,3342337,4718593,7012353,7340033,7471105,8585217,10420225,10485761,11206657,12189697,12713985,16121857,16908289,17039361,18284545,19595265,21102593],"predicates":[2031617,4784129,6946817,17891329],"promoter":[14548993,21626881],"params":[589825,720897,983041,1376257,1835009,2031617,2097153,2424833,2686977,3014657,3080193,3801089,4259841,4390913,4587521,4653057,4784129,4915201,4980737,5177345,5242881,5636097,5767169,6094849,6160385,6291457,6356993,6815745,6881281,6946817,7602177,7798785,8192001,8257537,8388609,8912897,9175041,10092545,10223617,10682369,10813441,11010049,11075585,11272193,11337729,11599873,11730945,11862017,12058625,12320769,12582913,12910593,13041665,13107201,13238273,13303809,13369345,13631489,13762561,13893633,13959169,14090241,14155777,14221313,14286849,14417921,14745601,14876673,15138817,15204353,15597569,15925249,16187393,16318465,16449537,16842753,16973825,17301505,17432577,17694721,17891329,18087937,18153473,18350081,18546689,18612225,18939905,19726337,19988481,20054017,20709377,20905985,21037057,21364737,21495809,21954561,22282241,22347777,22413313,22544385,22609921],"promote":[9633796,14548995,20578306,21626881],"private":[11141122,12779522,20185090],"pageresult":[2883593,8323074,21168131,23003138,23068675],"projections":[11141121,12779521,20185089],"parser":[458754,786434,4718593,6553601,9109506,9633794,11141121,11206659,12779521,14548994,20185089,20578305,21626882],"props":[20185090],"promotion":[14548993,21626881],"param":[589828,2883587,4653060,5242884,7667714,7798787,8192005,9175043,11665409,11862023,13369347,14417924,14745604,14876675,15597574,16384002,18022401,19726340,20119555,20643841,21037060,21430273,21495811],"projects":[1441796,1835009,3801089,4980737,8323084,8912897,10223617,10878984,13631489,15925249,16318465,19988481,20709377,21954561,22347777,23003148],"pass":[6356993,7602177,8257537,10092545,14155777,18939905],"provides":[1638403,1769473,3211265,5111810,7995395,12189697,17629186,18808835,19660801,21757953,22872065,23003137],"page":[2883587,3276802,4063234,6619143,8323074,10485763,14614531,16908291,17235970,19070980,19202051,19857409,20119564,20971523,21168132,23003138],"parent":[5963777,7340033,20316161],"projection":[917505,1835011,3801090,4980738,5177345,6815745,8912898,10223618,10354689,11599873,13631491,15138817,15925251,16318466,19922945,19988482,20709378,21233665,21954563,22347778,22544385],"package":[3473409,7405569,18284545],"password":[20709377,22347777],"pagesize":[2883587,6619138,8323073,10485761,14614529,16908289,17235970,20119555,20971521,21168131,23003137,23068673],"property":[1048578,1179650,1507330,1638405,2293762,2621442,3276802,3538946,3604482,4063234,4194306,4325380,4849667,5111814,5570562,6488066,6684674,7143426,7995395,8519684,8650754,9109506,9371650,10289154,11141121,11796482,11927554,12124162,12386306,12779521,12845058,14024706,14811138,16252930,17235970,18677762,18808838,19267586,19333122,19595266,19791874,20185089,20316162,20512770,22216706],"pairs":[393217,9306113],"permissions":[4980738,8912898],"provider":[3342337,8978433,14352385,15990788,16121857,21692420],"provide":[393217,9306113],"predicate":[720901,851971,917505,1376260,1835010,2097157,2424837,3014660,3080193,3801089,3997698,4259845,4390916,4587525,4653059,4980737,5439489,5767172,6094851,6160389,6291461,6356996,6881285,7536641,7602180,7798787,8257540,8323075,8388612,8912897,9502721,9568257,9961473,10092548,10223617,10354689,10682371,10813444,11010052,11075589,11272196,11337732,11599873,11730945,12058628,12320772,12582917,13041665,13107204,13303811,13631490,13762564,13893637,13959172,14090244,14155780,14221316,14286852,14483457,15138817,15204355,15794177,15925250,16318465,16449540,16973828,17104897,17301508,17432580,18087940,18153476,18350084,18546692,18612225,18939908,19988481,20054021,20709377,20905988,21954562,22282244,22347777,22413316,23003139],"parameterexpression":[786434,983043,2686979,4915203,5963777,7340033,8192011,8847365,11796481,13565957,16056325,17694723],"pwd":[20709377,22347777],"parse":[458755,4718594,11206658],"performing":[2031617,4784129,6946817,17891329],"performed":[1638401],"parameter":[458753,589825,720897,917505,1114113,1179649,1310721,1376257,1835009,1966081,2031617,2097153,2424833,2818049,2883585,3014657,3080193,3735553,3801089,3997697,4259841,4390913,4521985,4587521,4653057,4784129,4980737,5177345,5242881,5439489,5701633,5767169,5963777,6029313,6094849,6160385,6291457,6356993,6422529,6619137,6815745,6881281,6946817,7274497,7340033,7536641,7602177,7667713,7798785,8257537,8388609,8912897,9043969,9175041,9502721,9568257,9830401,9895937,9961473,10092545,10223617,10354689,10682369,10813441,10944513,11010049,11075585,11272193,11337729,11468801,11599873,11665409,11730945,11862017,11993089,12058625,12255233,12320769,12582913,12976129,13041665,13107201,13172737,13303809,13369345,13631489,13697025,13762561,13893633,13959169,14090241,14155777,14221313,14286849,14417921,14483457,14745601,14876673,15073281,15138817,15204353,15269889,15597569,15794177,15859713,15925250,16318465,16384001,16449537,16515073,16580609,16646145,16973825,17104897,17301505,17367041,17432577,17825793,17891329,18022401,18087937,18153473,18219009,18350081,18546689,18612225,18743297,18874369,18939905,19005441,19136513,19529729,19791873,19922945,19988481,20054017,20119553,20250625,20381697,20643841,20709377,20774913,20905985,21168129,21233665,21430273,21495809,21823489,21889025,21954561,22085633,22282241,22347777,22413313,22478849,22544385,22675457]}
\ No newline at end of file
diff --git a/docs/fti/FTI_113.json b/docs/fti/FTI_113.json
deleted file mode 100644
index e10a7307a..000000000
--- a/docs/fti/FTI_113.json
+++ /dev/null
@@ -1 +0,0 @@
-{"queryoptimizer":[3473410,7405571,17629185,18284547],"queries":[1769473,3473409,5963777,7340033,7405569,14811137,17629186,18284546,19660801,21757953,22872065,23003137],"questions":[12779521,17629185],"queryable":[917506,1048580,3080195,3604484,3801090,6094852,6356995,6422530,6881285,9830403,10092547,10354690,10485762,10682372,11599874,11730945,12582917,13041667,13303812,14090243,14614530,15138818,15204356,16908290,17825794,18153475,18612225,19136513,19922946,19988482,20709377,20971522,21233666,22347777,22675457],"querying":[1769474,17629186,19660802,21757954,22872066,23003138],"queryableanalyzer":[5963777,7340033,8978433,17629185,20512770],"query":[3342337,5963777,7340033,8978433,14352385,14811137,15990788,16121857,21692420]}
\ No newline at end of file
diff --git a/docs/fti/FTI_114.json b/docs/fti/FTI_114.json
deleted file mode 100644
index 5c5bacc96..000000000
--- a/docs/fti/FTI_114.json
+++ /dev/null
@@ -1 +0,0 @@
-{"replacement":[983041,2686977,4915201,5636097,12910593,13238273,16187393,16842753,17694721,21364737,22609921],"resultsingledescending":[3080193,11730945,13041665,18612225],"resultsingle":[3080193,11730945,13041665,18612225],"reverse":[8323073,22478852,23003137],"resultselector":[917506,1835010,2031618,4784130,6946818,10354690,11862019,13631490,15597571,15925250,17891330,19922946,21233666,21954562],"registered":[524289,655362,5308418,6750210,10420228,10551298,12189700,12517377,14942209,15532033,18481153,21102594,22740993,22937602],"resolvetypesbysimplename":[5963777,7340033,9371650],"return":[458753,524289,589825,720898,917505,983041,1114113,1179649,1310721,1376258,1638401,1769473,1835009,1966082,2031617,2097154,2424834,2555905,2686977,2818050,2883585,3014658,3080193,3735553,3801089,3997698,4259842,4390914,4521986,4587522,4653057,4784129,4849665,4915201,4980737,5177345,5242881,5439490,5636097,5701634,5767169,6029313,6094849,6160386,6291458,6356993,6422529,6619139,6815745,6881281,6946817,7274497,7536642,7602177,7667713,7733249,7798785,7995393,8192001,8257537,8388610,8912897,9043969,9175041,9502722,9568258,9633793,9699329,9830401,9895937,9961474,10092545,10223617,10354689,10682369,10813442,10944513,11010050,11075586,11272194,11337730,11468801,11599873,11665409,11730945,11862017,11993090,12058625,12255234,12320770,12517377,12582913,12648449,12910593,12976129,13041665,13107202,13172737,13238273,13303809,13369345,13500417,13631489,13697025,13762562,13893634,13959170,14090241,14155777,14221314,14286850,14417921,14483457,14745601,14876673,14942209,15073282,15138817,15204353,15269889,15400961,15532033,15597569,15794178,15859713,15925249,15990785,16187393,16318465,16384001,16449538,16515073,16580610,16646145,16711681,16842753,16973826,17104898,17170433,17301506,17367041,17432578,17629185,17694721,17825793,17891329,18022401,18087938,18153473,18219010,18350081,18481153,18546689,18612225,18743297,18874369,18939905,19005443,19136514,19267585,19333121,19529730,19660801,19726337,19922945,19988481,20054018,20119553,20185089,20250626,20381698,20643841,20709377,20774914,20905986,21037057,21168131,21233665,21364737,21430273,21495809,21692417,21757953,21823490,21889026,21954561,22085633,22282242,22347777,22413314,22478849,22544385,22609921,22675459,22740993,22872065,23003137],"result1":[6094849,6356993,6881281,9830401,10092545,10682369,12582913,13303809,14090241,15204353,18153473],"result2":[6094849,6356993,6881281,9830401,10092545,10682369,12582913,13303809,14090241,15204353,18153473],"result3":[6094849,6881281,10682369,12582913,13303809,15204353],"result4":[6881281,12582913],"result5":[6881281,12582913],"reference":[131073,196609,262145,327681,393217,458753,524289,589825,655361,720897,786433,851969,917505,983041,1048577,1114113,1179649,1245185,1310721,1376257,1441793,1507329,1572865,1638401,1703937,1835009,1900545,1966081,2031617,2097153,2162689,2293761,2359297,2424833,2490369,2555905,2621441,2686977,2752513,2818049,2883585,2949121,3014657,3080193,3145729,3276801,3342337,3407873,3473410,3538945,3604481,3670017,3735553,3801089,3866625,3932161,3997697,4063233,4128769,4194305,4259841,4325377,4390913,4456449,4521985,4587521,4653057,4718593,4784129,4849665,4915201,4980737,5111809,5177345,5242881,5308417,5373953,5439489,5505025,5570561,5636097,5701633,5767169,5832705,5898241,5963777,6029313,6094849,6160385,6225921,6291457,6356993,6422529,6488065,6553601,6619137,6684673,6750209,6815745,6881281,6946817,7012353,7077889,7143425,7208961,7274497,7340033,7405570,7471105,7536641,7602177,7667713,7733249,7798785,7864321,7929857,7995393,8060929,8126465,8192001,8257537,8323073,8388609,8454145,8519681,8585217,8650753,8716289,8781825,8847361,8912897,8978433,9043969,9109505,9175041,9240577,9306113,9371649,9437185,9502721,9568257,9633793,9699329,9764865,9830401,9895937,9961473,10027009,10092545,10158081,10223617,10289153,10354689,10420225,10485761,10551297,10616833,10682369,10747905,10813441,10878977,10944513,11010049,11075585,11141121,11206657,11272193,11337729,11403265,11468801,11534337,11599873,11665409,11730945,11796481,11862017,11927553,11993089,12058625,12124161,12189697,12255233,12320769,12386305,12451841,12517377,12582913,12648449,12713985,12779521,12845057,12910593,12976129,13041665,13107201,13172737,13238273,13303809,13369345,13434881,13500417,13565953,13631489,13697025,13762561,13828097,13893633,13959169,14024705,14090241,14155777,14221313,14286849,14352385,14417921,14483457,14548993,14614529,14680065,14745601,14811137,14876673,14942209,15007745,15073281,15138817,15204353,15269889,15335425,15400961,15466497,15532033,15597569,15663105,15728641,15794177,15859713,15925249,15990785,16056321,16121857,16187393,16252929,16318465,16384001,16449537,16515073,16580609,16646145,16711681,16777217,16842753,16908289,16973825,17039361,17104897,17170433,17235969,17301505,17367041,17432577,17498113,17563649,17694721,17760257,17825793,17891329,17956865,18022401,18087937,18153473,18219009,18284546,18350081,18415617,18481153,18546689,18612225,18677761,18743297,18808833,18874369,18939905,19005441,19136513,19202049,19267585,19333121,19398657,19464193,19529729,19595265,19660801,19726337,19791873,19922945,19988481,20054017,20119553,20185089,20250625,20316161,20381697,20447233,20512769,20578305,20643841,20709377,20774913,20840449,20905985,20971521,21037057,21102593,21168129,21233665,21299201,21364737,21430273,21495809,21561345,21692417,21823489,21889025,21954561,22020097,22085633,22151169,22216705,22282241,22347777,22413313,22478849,22544385,22609921,22675457,22740993,22806529,22872065,22937601,23003137,23068673],"results":[2031617,5898242,6946817,8323074,23003138],"runtime":[393217,5505026,17760257],"remarks":[720897,1376257,2097153,2818049,4259841,4521985,4587521,5439489,5701633,5767169,6029313,6160385,6291457,7536641,7602177,8257537,8388609,10813441,11010049,11075585,11337729,11993089,12058625,12255233,12976129,13959169,14155777,14286849,15269889,16580609,17301505,17432577,18350081,18546689,18743297,18939905,20054017,20381697,20905985,21889025,22282241,22413313],"rowcount":[8323073,8650754,10485761,14614529,16908289,20971521,21168129,23003137,23068673],"resultparametername":[13631491,21954563],"read":[11141121,12779521,20185089],"returning":[18219009],"root":[393217,5963777,7340033,17760257,20316161],"returned":[1835009,5963777,7340033,8323076,9371649,10878980,11141121,12779521,13631489,15925249,20185089,21954561,23003140],"remove":[9830401],"returns":[131076,327682,393218,589825,655361,720897,1376257,1572867,1638402,1900547,1966081,2097153,2359300,2424833,2752513,2818049,2883585,3014657,3145729,3342337,3407875,3670019,3866628,3997697,4259841,4390913,4521985,4587521,4653057,4718593,5111809,5242881,5373970,5439489,5701633,5767169,6029313,6160385,6291457,6356993,6422529,6619137,6750209,7012353,7077891,7340033,7471105,7536641,7667713,7733249,7798785,7864323,7995394,8126482,8192001,8323112,8388609,8585217,8781828,9043969,9175041,9502721,9568257,9764867,9830401,9895937,9961473,10092545,10420226,10485761,10616834,10682369,10813441,11010049,11075585,11141121,11206657,11272193,11337729,11403268,11665409,11862017,11993089,12058625,12189698,12255233,12320769,12451843,12648449,12713985,12779521,13107201,13303809,13369345,13434882,13500417,13762561,13893633,13959169,14090241,14221313,14286849,14417921,14745601,14876673,15007747,15073281,15335428,15400961,15597569,15728644,15794177,16121857,16384001,16449537,16580609,16777219,16908289,16973825,17039361,17104897,17170433,17301505,17432577,17498115,17760258,18022401,18087937,18153473,18219009,18284545,18350081,18546689,18743297,18808833,19005441,19136513,19202049,19529729,19595265,19660818,19726337,20054017,20119553,20185089,20250625,20381697,20447236,20643841,20774913,20840452,20905985,21037057,21102593,21168129,21430273,21495809,21823489,21889025,22151171,22282241,22413313,22675457,22872082,22937601,23003176,23068673],"resultmultiple":[3080193,11730945,13041665,18612225],"result":[458754,720897,917506,983041,1376257,1638404,1835011,2031617,2097153,2686977,2818049,3801089,4259841,4521985,4587521,4718593,4784129,4915201,4980738,5177345,5439489,5636097,5701633,5767169,6029313,6160385,6291457,6422529,6815745,6946817,7012353,7536641,7602177,8060931,8257537,8323085,8388609,8912898,10223617,10354690,10813441,10878980,11010049,11075585,11206657,11337729,11599873,11730948,11993089,12058625,12255233,12910593,12976129,13238273,13631491,13959169,14155777,14286849,15138817,15269889,15925251,16187393,16318465,16580609,16842753,17301505,17432577,17629185,17694721,17825793,17891329,17956870,18350081,18546689,18612228,18743297,18939905,19922946,19988481,20054017,20381697,20709378,20905985,21233666,21364737,21889025,21954563,22282241,22347778,22413313,22544385,22609921,23003149],"runs":[1179649,8323073,23003137],"resolvetypebysimplename":[524290,655361,5308419,6750209,10420226,12189698,15532034,18481156,21102593,22937601],"resulting":[262147,1835009,2621441,4980737,7012355,8323080,8912897,10223617,10878984,11927553,12124161,13631489,15925249,16318465,21954561,23003144],"renameparameterexpression":[5963777,7340033,11796482],"reflection":[17629185,18808833],"retrieve":[17629185,19464193],"roles":[4980737,6094849,8912897,9830401,10223618,10682369,13303809,15204353,16318466],"resultselectorargs":[1835010,13631490,15925250,21954562],"reclaimed":[655361,2752513,3145729,3342337,4718593,7012353,7340033,7471105,8585217,10420225,10485761,11206657,12189697,12713985,16121857,16908289,17039361,18284545,19595265,21102593],"resolvetype":[655361,6750209,10420226,10551299,12189698,12517378,14942210,21102593,22740996,22937601],"redirected":[1],"row":[8650754,10485761,14614529,16908289,20971521],"resolved":[524289,12517377,14942209,15532033,18481153,22740993],"representation":[393218,9306113,13500418,17760257],"requested":[19070977],"remark":[5963777,7340033,19791873],"represents":[393217,655361,720897,917505,1376257,2097153,2228225,2752513,2818049,3145729,3342337,3866625,4259841,4521985,4587521,4718593,5046273,5177345,5439489,5701633,5767169,6029313,6160385,6291457,6815745,7340033,7536641,7602177,8257537,8388609,8585217,10354689,10420225,10485761,10813441,11010049,11075585,11206657,11337729,11599873,11993089,12058625,12189697,12255233,12713985,12976129,13959169,14155777,14286849,15138817,15269889,15400961,16121857,16580609,16908289,17039361,17301505,17432577,18284545,18350081,18546689,18743297,18939905,19595265,19922945,20054017,20381697,20447233,20905985,21102593,21233665,21889025,22020097,22282241,22413313,22544385],"resulttype":[458754,983042,2686978,4915202,4980738,5636098,8912898,12910594,13238274,16187394,16842754,17694722,20709378,21364738,22347778,22609922],"resources":[655361,2752513,3145729,3342337,4718593,7012353,7340033,7471105,8585217,10420225,10485761,11206657,12189697,12713985,16121857,16908289,17039361,18284545,19595265,21102593],"renames":[5963777,7340033,11796481],"remaining":[6356993,8323075,10092545,13434882,18219010,23003139],"resolve":[524290,655362,3211266,5308418,5963777,6750210,7340033,9371649,10420228,10551298,12189701,12517378,14942210,15532034,18481154,21102594,22740994,22937603]}
\ No newline at end of file
diff --git a/docs/fti/FTI_115.json b/docs/fti/FTI_115.json
deleted file mode 100644
index 46b6276dc..000000000
--- a/docs/fti/FTI_115.json
+++ /dev/null
@@ -1 +0,0 @@
-{"setters":[17629185,18808833],"system":[65537,131074,196613,262146,327682,393224,458759,524295,589860,655362,720900,786441,851970,917514,983050,1048581,1114119,1179656,1245189,1310727,1376261,1441794,1507333,1572865,1638407,1703941,1769473,1835018,1900545,1966086,2031628,2097156,2162690,2228227,2293762,2359298,2424840,2490370,2555910,2621445,2686986,2752514,2818051,2883609,2949122,3014665,3080200,3145730,3211266,3276805,3342344,3407873,3473410,3538951,3604485,3670017,3735560,3801096,3866626,3932166,3997703,4063237,4128770,4194309,4259844,4325381,4390920,4456449,4521987,4587525,4653092,4718594,4784139,4849670,4915211,4980746,5046274,5111810,5177352,5242916,5308418,5373953,5439491,5505031,5570562,5636106,5701635,5767172,5832709,5898242,5963778,6029315,6094857,6160389,6225925,6291461,6357000,6422534,6488070,6553602,6619144,6684674,6750211,6815751,6881288,6946827,7012359,7077889,7143429,7208967,7274502,7340040,7405573,7471106,7536643,7602181,7667731,7733254,7798809,7864321,7929858,7995399,8060930,8126465,8192058,8257540,8323074,8388613,8454146,8519685,8585218,8650757,8716293,8781826,8847362,8912905,8978437,9043975,9109509,9175065,9240578,9306114,9371653,9437189,9502727,9568263,9633801,9699334,9764865,9830406,9895942,9961479,10027010,10092553,10158082,10223625,10289157,10354697,10420227,10485768,10551298,10616834,10682376,10747911,10813444,10878978,10944518,11010052,11075589,11141124,11206663,11272200,11337732,11403266,11468807,11534338,11599880,11665422,11730953,11796485,11862086,11927557,11993091,12058628,12124165,12189705,12255235,12320777,12386309,12451841,12517383,12582921,12648454,12713986,12779529,12845061,12910601,12976131,13041673,13107208,13172742,13238282,13303817,13369369,13434882,13500421,13565959,13631500,13697031,13762568,13828098,13893641,13959173,14024709,14090248,14155781,14221321,14286852,14352386,14417956,14483463,14548997,14614530,14680066,14745636,14811141,14876697,14942214,15007745,15073286,15138825,15204360,15269891,15335426,15400965,15466498,15532038,15597622,15663106,15728642,15794183,15859719,15925259,15990791,16056322,16121858,16187403,16252935,16318472,16384019,16449545,16515078,16580611,16646151,16711685,16777217,16842760,16908296,16973832,17039362,17104903,17170437,17235973,17301509,17367046,17432581,17498113,17563653,17629187,17694729,17760258,17825798,17891340,17956866,18022412,18087945,18153481,18219015,18284551,18350085,18415617,18481158,18546693,18612232,18677765,18743299,18808839,18874375,18939908,19005447,19070977,19136518,19202050,19267590,19333126,19398658,19464197,19529734,19595271,19660802,19726385,19791877,19857409,19922952,19988489,20054020,20119577,20185097,20250630,20316165,20381699,20447240,20512773,20578306,20643852,20709386,20774918,20840450,20905988,20971522,21037100,21102600,21168136,21233673,21299202,21364746,21430286,21495833,21561349,21626883,21692423,21757953,21823494,21889027,21954573,22020101,22085640,22151169,22216709,22282245,22347785,22413316,22478854,22544391,22609929,22675463,22740998,22806535,22872066,22937606,23003143,23068674],"simpletypename":[524290,15532034,18481154],"subgroups":[262146,5177346,6815746,7012354,8060931,8323075,11927555,22544386,23003139],"series":[6356993,10092545],"shared":[17629185,23003137],"similar":[720897,917505,1376257,1835010,2031617,2097153,2424833,3014657,3080193,3801089,4259841,4390913,4587521,4784129,4980737,5767169,6094849,6160385,6291457,6356993,6881281,6946817,7602177,8257537,8388609,8912897,10092545,10223617,10354689,10682369,10813441,11010049,11075585,11272193,11337729,11599873,11730945,12058625,12320769,12582913,13041665,13107201,13303809,13631490,13762561,13893633,13959169,14090241,14155777,14221313,14286849,15138817,15204353,15925250,16318465,16449537,16973825,17301505,17432577,17891329,18087937,18153473,18350081,18546689,18612225,18939905,19988481,20054017,20905985,21954562,22282241,22413313],"supply":[5963777,7340033,19791873],"skipwhile":[6356997,8323074,10092549,13434883,23003138],"sampleobject":[1638402,7995396],"sorted":[3080193,11730945,13041665,18612225],"statement":[1638401,7995393],"setdynamicpropertyvalue":[5111810,6488067,6684675,16252931,18808834],"stackoverflow":[12779521,17629185],"solutionizing":[1441794,8323074,20709377,22347777,23003138],"shallow":[655361,2752513,3145729,3342337,4718593,7012353,7340033,7471105,8585217,10420225,10485761,11206657,12189697,12713985,16121857,16908289,17039361,18284545,19595265,21102593],"supportslinqtoobjects":[3342337,8978433,14352385,15990787,16121857,21692418],"scan":[5963777,7340033,9371649],"satisfies":[131075,720897,1376259,1572866,1900550,2097153,2359299,2424833,3014657,3670018,3997697,4259841,4390913,4456450,4587521,5373968,5439491,6160385,6291457,7077894,7536643,7602177,8126480,8257537,8323090,8388609,8781827,9043969,9502721,9568257,9764866,9961473,10682369,10813441,11010051,11075585,11272193,11337729,11403267,12320769,12451842,13107201,13303809,13762561,13893633,13959171,14155777,14221313,14286851,15007746,15335427,15794177,16449537,16777218,16973825,17104897,17301505,17432577,17498114,18087937,18415618,18939905,19660816,20054017,20840451,20905985,22151170,22282241,22413313,22872080,23003154],"search":[65537,19070977],"source":[393217,589827,720900,917506,1114114,1179651,1310723,1376258,1835012,1966084,2097156,2424836,2818051,2883587,3014659,3080194,3735556,3801091,3997700,4259844,4390915,4521987,4587524,4653059,4980738,5177346,5242883,5439490,5505025,5701635,5767170,6029314,6094851,6160388,6291460,6356995,6422530,6619138,6815746,6881282,7274498,7536642,7602179,7667715,7798787,8257539,8388611,8912898,9043970,9175043,9306113,9502723,9568259,9633793,9830403,9895938,9961475,10092547,10223618,10354690,10485761,10682370,10813443,10944514,11010050,11075588,11272195,11337731,11468804,11599874,11665411,11730946,11993092,12058626,12255236,12320771,12582914,12976131,13041666,13107203,13172738,13303810,13369347,13631492,13697027,13762563,13893636,13959170,14090242,14155779,14221315,14286850,14417923,14483458,14745603,14876675,15073283,15138818,15204355,15269891,15794179,15859714,15925252,16318466,16384003,16449539,16515074,16580611,16646147,16973827,17104899,17301507,17367042,17432579,17825795,18022403,18087939,18153474,18219010,18350082,18546690,18612226,18743298,18874372,18939907,19005443,19136516,19529730,19922946,19988483,20054020,20119555,20250627,20381700,20643843,20709379,20774914,20905987,21168130,21233666,21430275,21495811,21823492,21889028,21954564,22085635,22282243,22347779,22413315,22478850,22544386,22675460],"stringproperty":[917505,3080193,3801089,6881283,10354689,11730945,12582915,13041665,18612225,19922945,19988481,21233665],"specifies":[1638401,7995393],"sampleproperty":[1638402,7995395],"specified":[131075,327682,393218,458753,655361,720899,917505,983041,1179649,1310721,1376257,1572866,1900547,2097155,2359299,2424835,2686977,2752513,3014657,3080193,3145729,3342338,3670018,3735554,3866626,3997699,4128769,4259843,4390913,4587523,4718594,4849665,4915201,5177345,5373963,5439489,5636097,6160387,6291459,6356994,6815745,6881281,7012353,7077891,7340033,7471105,7536641,7602177,8060931,8126475,8257537,8323113,8388609,8454147,8585217,8781827,8978433,9043969,9502721,9568257,9764866,9961473,10092546,10354689,10420225,10485761,10616834,10682369,10747905,10813441,11010049,11075587,11141121,11206658,11272193,11337729,11403267,11468802,11599873,11730945,12189697,12320769,12451842,12582913,12713985,12779521,12910593,13041665,13107201,13238273,13303809,13434882,13762561,13893635,13959169,14090242,14155777,14221313,14286849,14352385,14483457,14680067,15007746,15138817,15335427,15794177,15990785,16121858,16187393,16449537,16646145,16777218,16842753,16908289,16973825,17039361,17104897,17301505,17432577,17498114,17694721,17760257,17956870,18087937,18153474,18219010,18284545,18612225,18808833,18874370,18939905,19005442,19136513,19595265,19660811,19922945,20054019,20185089,20447234,20840451,20905985,21102593,21233665,21364737,21692417,22085633,22151170,22282241,22413313,22544385,22609921,22675457,22872075,23003177],"setmemberbinder":[7995394],"singlefield":[3801089,19988481],"stays":[11141121,12779521,20185089],"selector":[1835009,3801090,4980738,5242883,8323076,8912898,9175043,10223618,10878980,13369347,13631489,14745603,15925249,16318466,19988482,20709378,21954561,22347778,23003140],"sequence":[131076,327682,720897,851971,917505,1114113,1310721,1376258,1441796,1572867,1835015,1900547,1966082,2031623,2097153,2162690,2359308,2424833,2490370,2818049,3014658,3080194,3407875,3670020,3735553,3801090,3997697,4259841,4390914,4456451,4521985,4587521,4784133,4980740,5177345,5373975,5439490,5701633,5767170,6029314,6094851,6160385,6291457,6356994,6422530,6815745,6881282,6946823,7077891,7274497,7536642,7602178,7864323,8060931,8126487,8257538,8323174,8388609,8781828,8912900,9043970,9240580,9502721,9568259,9764868,9830403,9895937,9961474,10092546,10223620,10354689,10616836,10682370,10813441,10878996,10944515,11010050,11075585,11141121,11272195,11337729,11403272,11468801,11599873,11730946,11993090,12058626,12255234,12320770,12451843,12582914,12779521,12976130,13041666,13107201,13172737,13303810,13434882,13631495,13697027,13762562,13893633,13959170,14090243,14155778,14221313,14286850,14483458,15007747,15073281,15138817,15204355,15269890,15335429,15728644,15794177,15859713,15925255,16318468,16449537,16515073,16580609,16646145,16777220,16973825,17104898,17170433,17301505,17367041,17432577,17498116,17825795,17891333,17956870,18087939,18153475,18219010,18350082,18415619,18546690,18612226,18743298,18874369,18939906,19005442,19136514,19529731,19660823,19922945,19988482,20054017,20185089,20250625,20381698,20709378,20774917,20840456,20905985,21233665,21823490,21889026,21954567,22085633,22151171,22282241,22347778,22413313,22478851,22544385,22675459,22872087,23003238],"specific":[393217,7995393,9306113],"setting":[5111809,5963777,7340033,7995393,18808833,19791873],"start":[8323073,19005442,23003137],"sum":[1179649,8323074,10944517,23003138],"second":[2031618,4784129,6946818,17891329],"showing":[7012353,7471105,15400961],"stringpropertyaskey":[917505,10354689,11599873,15138817,19922945,21233665],"setdynamicproperty":[20185090],"sharp":[12779521,17629185],"summary":[589825,2228225,2883585,4653057,5242881,7667713,7798785,8192001,9175041,11665409,11862017,13369345,14417921,14745601,14876673,15597569,16384001,18022401,19726337,20119553,20643841,21037057,21430273,21495809,21626881],"sensitive":[1638401,7995393],"supplied":[5963777,7340033,11796481],"sort":[65537,1769473,17629185,19660801,21757953,22872065,23003137],"structures":[1769473,17629185,19660801,21757953,22872065,23003137],"serialization":[5505026],"serialized":[5505025],"stack":[393217,9306113],"simple":[524290,655361,5308418,5963778,6750209,7340034,9371650,10420226,12189698,15532033,18481153,21102593,22937601],"starting":[6356993,10092545],"sorry":[19070977,19857409],"stacktrace":[393217,9306113],"sets":[393220,1048577,3276801,3604481,4063233,4128769,4849665,5111810,5505025,5963781,6488065,6684674,7340037,8650753,9306115,10289153,10485765,12386305,14614533,16252929,16908293,17235969,17760257,18808835,19791873,20512769,20971525,22216705],"single":[1376258,1835009,4390915,5439490,7536642,8323080,10878980,11010050,11403269,12320771,13631489,13959170,14286850,15925249,17104899,19529733,20774914,21954561,23003144],"specify":[917506,1638401,5111810,5177345,6815745,7995393,10354690,11599873,15138817,18808834,19922946,21233666,22544385],"sealed":[393217,20447233],"suported":[5963777,7340033,9371649],"serializableattribute":[393217],"select":[1441799,3801093,6094849,8323078,9830401,10682369,11141121,12779521,13303809,13369353,14745610,15204353,19988485,20185089,20709380,22347780,23003142],"serves":[393217,655361,2752513,3145729,3342337,4718593,7012353,7340033,7471105,8585217,10420225,10485761,11206657,12189697,12713985,16121857,16908289,17039361,17760257,18284545,19595265,21102593],"streamingcontext":[393217,5505029,17760257],"site":[19857409],"singleordefault":[2359301,8323076,9568259,11272195,18087939,20774915,23003140],"size":[10485761,14614529,16908289,17235970,20971521],"strings":[720897,917505,1376257,1835010,2031617,2097153,2424833,3014657,3080193,3801089,4259841,4390913,4587521,4784129,4980737,5767169,6094849,6160385,6291457,6356993,6881281,6946817,7602177,8257537,8388609,8912897,10092545,10223617,10354689,10682369,10813441,11010049,11075585,11272193,11337729,11599873,11730945,12058625,12320769,12582913,13041665,13107201,13303809,13631490,13762561,13893633,13959169,14090241,14155777,14221313,14286849,15138817,15204353,15925250,16318465,16449537,16973825,17301505,17432577,17891329,18087937,18153473,18350081,18546689,18612225,18939905,19988481,20054017,20905985,21954562,22282241,22413313],"syntax":[196609,393217,458753,524289,589826,720898,786433,917506,983041,1048577,1114114,1179650,1245185,1310722,1376258,1507329,1638401,1703937,1835010,1966082,2031618,2097154,2424834,2555905,2621441,2686977,2818050,2883586,3014658,3080194,3276801,3342337,3538945,3604481,3735554,3801090,3932161,3997698,4063233,4194305,4259842,4325377,4390914,4521986,4587522,4653058,4784130,4849665,4915201,4980738,5177346,5242882,5439490,5505025,5636097,5701634,5767170,5832705,6029314,6094850,6160386,6225921,6291458,6356994,6422530,6488065,6619138,6815746,6881282,6946818,7012353,7143425,7208961,7274498,7340033,7405569,7536642,7602178,7667714,7733249,7798786,7995393,8192001,8257538,8388610,8519681,8650753,8716289,8912898,8978433,9043970,9109505,9175042,9371649,9437185,9502722,9568258,9633793,9699329,9830402,9895938,9961474,10092546,10223618,10289153,10354690,10485761,10682370,10747905,10813442,10944514,11010050,11075586,11206657,11272194,11337730,11468802,11599874,11665410,11730946,11796481,11862018,11927553,11993090,12058626,12124161,12189697,12255234,12320770,12386305,12517377,12582914,12648449,12779521,12845057,12910593,12976130,13041666,13107202,13172738,13238273,13303810,13369346,13500417,13565953,13631490,13697026,13762562,13828097,13893634,13959170,14024705,14090242,14155778,14221314,14286850,14417922,14483458,14548993,14745602,14811137,14876674,14942209,15073282,15138818,15204354,15269890,15400961,15532033,15597570,15794178,15859714,15925250,15990785,16187393,16252929,16318466,16384002,16449538,16515074,16580610,16646146,16711681,16842753,16908289,16973826,17104898,17170433,17235969,17301506,17367042,17432578,17563649,17694721,17825794,17891330,18022402,18087938,18153474,18219010,18284545,18350082,18481153,18546690,18612226,18677761,18743298,18808833,18874370,18939906,19005442,19136514,19267585,19333121,19464193,19529730,19595265,19660801,19726337,19791873,19922946,19988482,20054018,20119554,20185089,20250626,20316161,20381698,20447233,20512769,20643842,20709378,20774914,20905986,21037057,21102593,21168130,21233666,21364737,21430274,21495810,21561345,21692417,21823490,21889026,21954562,22020097,22085634,22216705,22282242,22347778,22413314,22478850,22544386,22609921,22675458,22740993,22806529,22872065,22937601,23003137],"set":[458753,983041,1048577,1507329,1769473,3276801,3473409,3604481,3932161,4063233,4194305,4849665,4915201,5111809,5636097,5963778,6553601,7340034,7405569,7995394,8650753,9109505,9371649,10289153,11141121,11206657,11796481,12386305,12779521,13238273,14811138,16187393,17235969,17629186,18284546,18808833,19660801,19791874,20185091,20316161,20512769,21757953,22216705,22872065,23003137],"subsequent":[393217,2162690,8323074,11730945,17760257,18612225,23003138],"satisfy":[3407874,5373954,5767170,6881281,7864322,8126466,12058626,12582913,14483457,18350082,18546690,19660802,22872066],"serializationinfo":[393218,5505030,17760258],"sequences":[2031618,4784130,4980737,5898242,6946818,7929858,8323080,8912897,10223617,10878980,16318465,17891330,23003144],"skip":[8323073,18219011,23003137],"sql":[5963777,7340033,14811137],"supports":[3342337,5963777,7340033,8978433,14352385,15990785,16121857,19791873,21692417],"string":[131074,327682,393220,458753,524290,655361,720900,786434,851970,917514,983043,1179652,1310723,1376260,1441796,1507329,1572866,1769473,1835016,1900546,2031626,2097156,2162690,2359298,2424836,2490370,2686979,2752513,3014660,3080197,3145729,3342337,3407874,3538946,3670018,3735555,3801094,3866625,4259844,4390916,4456450,4587524,4718594,4784138,4849666,4915203,4980741,5046273,5111812,5177349,5308418,5373966,5570562,5636099,5767172,5898246,5963778,6094852,6160388,6291460,6356996,6488067,6684674,6815749,6881285,6946826,7012353,7077890,7340035,7471105,7602180,7864322,7929862,8060932,8126478,8257540,8323154,8388612,8454146,8519682,8585217,8781826,8847371,8912901,9109506,9240578,9306114,9764866,10092548,10223621,10354698,10420229,10485761,10551298,10682372,10747907,10813444,10878992,11010052,11075588,11206658,11272196,11337732,11403266,11599878,11730949,12058628,12189701,12320772,12451842,12517378,12582917,12713985,12845057,12910595,13041669,13107204,13238275,13303812,13434882,13500420,13565963,13631502,13762564,13893636,13959172,14090244,14155780,14221316,14286852,14680066,14942210,15007746,15138822,15204356,15335426,15400964,15532034,15728642,15925256,16056331,16121857,16187395,16252931,16318469,16449540,16777218,16842755,16908289,16973828,17039361,17170434,17301508,17432580,17498114,17629185,17694723,17760257,17891338,17956880,18087940,18153476,18284545,18350084,18415618,18481156,18546692,18612229,18808836,18874371,18939908,19267587,19333123,19595265,19660815,19922953,19988486,20054020,20185089,20316161,20447233,20709381,20840450,20905988,21102593,21233673,21364739,21757953,21954574,22085635,22151170,22282244,22347781,22413316,22609923,22740996,22872079,23003219],"source_content":[5963777,7340033,14811137],"stringproperty1":[917505,3801089,10354689,19922945,19988481,21233665],"stringproperty2":[917505,3801089,10354689,19922945,19988481,21233665],"successful":[1638401,7995393],"selectmany":[1835011,4980741,5242890,8323082,8912901,9175049,10223620,10878987,13631491,15925251,16318468,21954563,23003146],"support":[1769473,21757953],"singleordefaultasync":[1376259,1900548,5373955,5439491,7077892,7536643,8126467,11010051,13959171,14286851,19660803,22872067],"sorts":[2490370,3080193,8323074,13041665,23003138],"symbols":[5963777,7340033,20316161],"scans":[3211265,12189697],"sure":[5963777,7340033,19791873],"supported":[720897,1376257,1572867,2097153,2818049,4259842,4521986,4587521,5373958,5439489,5701634,5767169,6029313,6160385,6291458,7536641,7602177,8126470,8257537,8388610,10813442,11010049,11075586,11337730,11993090,12058625,12255234,12976129,13959169,14155777,14286849,15007747,15269889,16580609,16777219,17301505,17432577,17498115,18350081,18546689,18743297,18939905,19660806,20054018,20381697,20905985,21889025,22282242,22413313,22872070],"static":[589825,720897,917505,983041,1114113,1179649,1310721,1376257,1769473,1835009,1966081,2031617,2097153,2424833,2686977,2818049,2883585,3014657,3080193,3735553,3801089,3997697,4259841,4390913,4521985,4587521,4653057,4784129,4915201,4980737,5177345,5242881,5439489,5636097,5701633,5767169,6029313,6094849,6160385,6291457,6356993,6422529,6619137,6815745,6881281,6946817,7143425,7208961,7274497,7405569,7536641,7602177,7667713,7798785,8192001,8257537,8388609,8912897,9043969,9175041,9502721,9568257,9830401,9895937,9961473,10092545,10223617,10354689,10682369,10813441,10944513,11010049,11075585,11272193,11337729,11468801,11599873,11665409,11730945,11862017,11993089,12058625,12255233,12320769,12582913,12779521,12910593,12976129,13041665,13107201,13172737,13238273,13303809,13369345,13565953,13631489,13697025,13762561,13828097,13893633,13959169,14024705,14090241,14155777,14221313,14286849,14417921,14483457,14745601,14876673,15073281,15138817,15204353,15269889,15597569,15794177,15859713,15925249,16187393,16318465,16384001,16449537,16515073,16580609,16646145,16842753,16973825,17104897,17301505,17367041,17432577,17629185,17694721,17825793,17891329,18022401,18087937,18153473,18219009,18350081,18546689,18612225,18743297,18874369,18939905,19005441,19136513,19529729,19660802,19726337,19922945,19988481,20054017,20119553,20185089,20250625,20381697,20643841,20709377,20774913,20905985,21037057,21168129,21233665,21364737,21430273,21495809,21757953,21823489,21889025,21954561,22085633,22282241,22347777,22413313,22478849,22544385,22609921,22675457,22806529,22872066,23003138],"singleton":[8323074,10616834,19136513,22675457,23003138]}
\ No newline at end of file
diff --git a/docs/fti/FTI_116.json b/docs/fti/FTI_116.json
deleted file mode 100644
index e0f55c9e8..000000000
--- a/docs/fti/FTI_116.json
+++ /dev/null
@@ -1 +0,0 @@
-{"typed":[5963777,7340033,8323073,9895938,11796481,23003137],"types":[655362,2555905,3211268,5963780,6750209,7340036,7733250,9371651,9699329,10420227,12189701,12386305,12648450,14548993,21102594,21626881,22937602],"throws":[393217,1376257,1900547,2359300,4390913,5373955,5439489,7077891,7536641,8126467,8323080,9306113,9568257,11010049,11272193,11403268,12320769,13959169,14286849,17104897,18087937,19529729,19660803,20774913,22872067,23003144],"try":[655361,2752513,3145729,3342337,4718593,7012353,7340033,7471105,8585217,10420225,10485761,11206657,12189697,12713985,16121857,16908289,17039361,18284545,19070977,19595265,19857409,21102593],"typeid":[10027009,20447233],"typeprovider":[3211265,21102593],"takewhile":[327683,8323074,14090245,18153477,23003138],"tresult":[1441798,5242887,8192007,8323082,8847366,9175047,10878980,13369351,13565958,14745607,16056326,19726343,20709377,21037063,22347777,23003146],"todo":[1835009,13631489,15925249,21954561],"targetsite":[393217,9306113],"typo":[19070977],"trysetmember":[5111809,7995394,18808833],"textparser":[458753,4718593,11206657],"todynamiclist":[7208963,7667719,11534340,11665415,19398659,20643846],"task":[720900,1114114,1376261,2097156,2818053,4259844,4521989,4587525,5439493,5701637,5767172,6029317,6160389,6291461,7274498,7536645,7602181,8257540,8388613,10813444,11010052,11075589,11337732,11993093,12058628,12255237,12976133,13172738,13959173,14155781,14286852,15269893,16384002,16580613,17301509,17432581,18022402,18350085,18546693,18743301,18939908,20054020,20381701,20905988,21430274,21889029,22282245,22413316],"true":[327682,458754,983041,1638401,3932162,4915201,5636097,5963778,6094849,6356993,7340034,7602177,7995393,8257537,8323076,10092545,12976129,13238273,13434882,13697025,14090241,14155777,15204353,15269889,15990785,16187393,17825793,18153473,18939905,19791873,20185090,20316161,21692417,23003140],"threading":[1376257,2818049,4521985,4587521,5439489,5701633,6029313,6160385,6291457,7536641,7602177,8388609,11075585,11993089,12255233,12976129,13959169,14155777,15269889,16580609,17301505,17432577,18350081,18546689,18743297,20381697,21889025,22282241],"title":[65537],"time":[1638402,1769473,7995394,17629185,19660801,21757953,22872065,23003137],"type":[262145,393218,458759,524295,589831,655364,720901,786436,917511,983050,1048577,1114122,1179653,1310727,1376262,1441796,1507331,1638403,1769473,1835015,1966083,2031625,2097157,2293763,2424837,2555908,2621441,2686986,2752514,2818052,2883590,2949121,3014662,3080197,3145730,3211268,3276801,3342338,3473409,3538951,3604481,3735560,3801093,3866626,3932161,3997700,4063233,4128769,4194306,4259845,4325383,4390917,4521988,4587526,4653063,4718595,4784136,4849667,4915211,4980747,5111809,5177351,5242887,5308418,5439492,5505026,5636110,5701636,5767173,5963781,6029316,6094854,6160390,6291462,6356997,6422531,6488068,6553601,6619141,6750211,6815750,6881285,6946824,7012354,7143425,7208961,7274501,7340038,7405569,7471106,7536644,7602182,7667719,7733249,7798790,7995395,8192007,8257541,8323089,8388614,8454148,8519681,8585218,8650753,8847375,8912906,8978433,9043972,9109505,9175046,9306113,9371650,9502724,9568260,9633802,9699332,9830403,9895940,9961476,10027009,10092550,10158081,10223622,10289153,10354694,10420230,10485764,10551298,10616834,10682373,10747906,10813445,10878978,10944515,11010053,11075590,11141123,11206659,11272197,11337733,11468812,11599877,11665412,11730950,11796481,11862026,11927553,11993092,12058629,12124161,12189703,12255236,12320774,12386305,12517383,12582918,12648449,12713986,12779523,12845057,12910605,12976132,13041670,13107205,13172739,13238282,13303814,13369350,13500417,13565967,13631497,13697028,13762565,13893638,13959174,14024705,14090245,14155782,14221318,14286853,14352385,14417927,14483460,14548994,14614529,14680068,14745607,14811137,14876678,14942214,15073283,15138822,15204357,15269892,15400961,15466497,15532038,15597577,15663105,15794180,15859722,15925256,15990787,16056335,16121858,16187407,16252930,16318469,16384007,16449542,16515075,16580612,16646156,16711681,16842760,16908290,16973829,17039362,17104900,17170433,17235969,17301510,17367045,17432582,17629185,17694729,17760258,17825795,17891337,18022403,18087942,18153478,18219012,18284546,18350086,18481158,18546694,18612229,18677761,18743300,18808833,18874375,18939909,19005444,19136516,19267586,19333124,19398657,19464193,19529731,19595268,19660801,19726342,19791873,19922949,19988486,20054021,20119558,20185099,20250627,20316161,20381700,20447236,20512769,20578305,20643843,20709388,20774915,20905989,20971521,21037062,21102596,21168133,21233670,21364750,21430276,21495814,21626881,21692419,21757953,21823491,21889028,21954570,22085640,22216705,22282246,22347787,22413317,22478851,22544390,22609929,22675461,22740998,22806529,22872065,22937604,23003154],"typeparam":[589825,2883585,4653057,5242881,7798785,8192001,9175041,11665409,11862017,13369345,14417921,14745601,14876673,15597569,19726338,20119553,21037057,21430273,21495809],"turn":[11141121,12779521,20185089],"top":[131073,262145,327681,393219,655361,851969,1441793,1572865,1900545,2162689,2293761,2359297,2490369,2752513,2949121,3145729,3342338,3407873,3473409,3670017,3866625,4128769,4456449,4718593,5111809,5308417,5373953,5570561,5898241,5963777,6553601,6684673,6750209,7012355,7077889,7208961,7340035,7471105,7864321,7929857,8060929,8126465,8323073,8454145,8585217,8781825,8847361,8978433,9240577,9306113,9764865,10027009,10158081,10420225,10485763,10551297,10616833,10878977,11141121,11206659,11403265,11534337,12189698,12451841,12713985,12779521,13434881,13565953,14352385,14548993,14614529,14680065,15007745,15335425,15466497,15663105,15728641,16056321,16121857,16777217,16908291,17039361,17498113,17760257,17956865,18284547,18415617,18808835,19070977,19202049,19398657,19464193,19595267,19660801,20447235,20578305,20840449,20971521,21102594,21299201,22151169,22806529,22872065,22937601,23003137,23068673],"trygetmember":[1638402,5111809,18808833],"topic":[1],"todynamicarrayasync":[1114115,7274499,10158084,13172739,15466499,22806531],"tdelegate":[8192001,19726337,21037057],"todynamiclistasync":[15466499,16384007,18022406,21299204,21430279,22806531],"typeof":[4980737,8912897,20185090,20709377,22347777],"typename":[524289,1310722,3735554,12517379,14942211,15532033,18481153,18874370,22085634,22740995],"tostring":[393218,655361,2752513,3145729,3342337,3866625,4718593,7012354,7340033,7471106,8585217,10420225,10485761,11206657,12189697,12713985,13500419,15400962,16121857,16908289,17039361,17629185,17760258,18284545,18808833,19595265,20447233,21102593],"tsource":[589831,851972,1048578,2162692,2490372,2883593,4653063,7798791,8323088,10485768,12713987,14417927,14876679,16908289,17629186,19202050,20119559,20971523,21495815,21561347,23003152,23068674],"todynamicarray":[7208963,15663108,15859715,16515075,17367043,19398659],"test":[720899,1376257,2097155,2424835,3014658,3997698,4259843,4390914,4587523,5767169,6094849,6160387,6291459,6356994,6881281,7602179,7995395,8257539,8388610,9502721,9568257,9961473,10092546,10682369,10813442,11010049,11075587,11272194,11337730,12058625,12320770,12582913,13107202,13303809,13762562,13893635,13959169,14090242,14155779,14221314,14286849,15204353,15794177,16449538,16973826,17104897,17301506,17432578,18087938,18153474,18350081,18546689,18939907,20054019,20905986,22282242,22413314],"thenby":[2162693,8323076,11730947,14417930,18612227,21495817,23003140],"thrown":[1638401,5505025,7995393],"two":[2031618,4784131,5898242,6946818,7929858,8323076,17891331,23003140],"telement":[5177351,6815751,7929864,8060935,8323087,11862029,15597581,22544394,23003151],"translation":[5963777,7340033,19791873]}
\ No newline at end of file
diff --git a/docs/fti/FTI_117.json b/docs/fti/FTI_117.json
deleted file mode 100644
index 4242b488f..000000000
--- a/docs/fti/FTI_117.json
+++ /dev/null
@@ -1 +0,0 @@
-{"usable":[5963777,7340033,20316161],"url":[19070977],"useparameterizednamesindynamicquery":[5963777,7340033,14811138],"unload":[11141121,12779521,20185089],"uses":[458753,4718593,11141121,11206657,12779521,20185089],"using":[8323073,9830401,17629185,18808833,23003137],"usage":[589825,720897,917505,1114113,1179649,1310721,1376257,1835009,1966081,2031617,2097153,2424833,2818049,2883585,3014657,3080193,3735553,3801089,3997697,4259841,4390913,4521985,4587521,4653057,4784129,4980737,5177345,5242881,5439489,5701633,5767169,6029313,6094849,6160385,6291457,6356993,6422529,6619137,6815745,6881281,6946817,7274497,7536641,7602177,7667713,7798785,8257537,8388609,8912897,9043969,9175041,9502721,9568257,9830401,9895937,9961473,10092545,10223617,10354689,10682369,10813441,10944513,11010049,11075585,11272193,11337729,11468801,11599873,11665409,11730945,11862017,11993089,12058625,12255233,12320769,12582913,12976129,13041665,13107201,13172737,13303809,13369345,13631489,13697025,13762561,13893633,13959169,14090241,14155777,14221313,14286849,14417921,14483457,14745601,14876673,15073281,15138817,15204353,15269889,15597569,15794177,15859713,15925249,16318465,16384001,16449537,16515073,16580609,16646145,16973825,17104897,17301505,17367041,17432577,17825793,17891329,18022401,18087937,18153473,18219009,18350081,18546689,18612225,18743297,18874369,18939905,19005441,19136513,19529729,19922945,19988481,20054017,20119553,20250625,20381697,20643841,20709377,20774913,20905985,21168129,21233665,21430273,21495809,21823489,21889025,21954561,22085633,22282241,22347777,22413313,22478849,22544385,22675457],"usability":[5963777,7340033,20316161],"understand":[6750209,7733249,10420225,12189697,12648449,22937601],"used":[983041,2031617,2686977,3211267,4784129,4915201,5636097,5898242,6946817,7929858,8323076,11141121,12189697,12779521,12910593,13238273,14548993,16187393,16842753,17629185,17694721,17891329,19464193,20185089,21102594,21364737,21626881,22609921,23003140],"unique":[655361,2555905,10027009,10420225,11141121,12189697,12779521,20185089,20447233,21102593],"usedynamicobjectclassforanonymoustypes":[5963777,7340033,12386306],"username":[20709377,22347777],"user":[393217,9306113,20709377,22347777],"users":[4980737,8912897,10223617,16318465,20709377,22347777]}
\ No newline at end of file
diff --git a/docs/fti/FTI_118.json b/docs/fti/FTI_118.json
deleted file mode 100644
index 205d830ce..000000000
--- a/docs/fti/FTI_118.json
+++ /dev/null
@@ -1 +0,0 @@
-{"version":[196609,393217,458753,524289,589825,720897,786433,917505,983041,1048577,1114113,1179649,1245185,1310721,1376257,1507329,1638401,1703937,1835009,1966081,2031617,2097153,2424833,2555905,2621441,2686977,2818049,2883585,3014657,3080193,3276801,3342337,3538945,3604481,3735553,3801089,3932161,3997697,4063233,4194305,4259841,4325377,4390913,4521985,4587521,4653057,4784129,4849665,4915201,4980737,5177345,5242881,5439489,5505025,5636097,5701633,5767169,5832705,5963777,6029313,6094849,6160385,6225921,6291457,6356993,6422529,6488065,6619137,6815745,6881281,6946817,7012353,7143425,7208961,7274497,7340034,7405569,7536641,7602177,7667713,7733249,7798785,7995393,8192001,8257537,8388609,8519681,8650753,8716289,8912897,8978433,9043969,9109505,9175041,9371649,9437185,9502721,9568257,9633793,9699329,9830401,9895937,9961473,10092545,10223617,10289153,10354689,10485761,10682369,10747905,10813441,10944513,11010049,11075585,11206657,11272193,11337729,11468801,11599873,11665409,11730945,11796481,11862017,11927553,11993089,12058625,12124161,12189697,12255233,12320769,12386305,12517377,12582913,12648449,12779521,12845057,12910593,12976129,13041665,13107201,13172737,13238273,13303809,13369345,13500417,13565953,13631489,13697025,13762561,13828098,13893633,13959169,14024705,14090241,14155777,14221313,14286849,14417921,14483457,14548993,14745601,14811137,14876673,14942209,15073281,15138817,15204353,15269889,15400961,15532033,15597569,15794177,15859713,15925249,15990785,16187393,16252929,16318465,16384001,16449537,16515073,16580609,16646145,16711681,16842753,16908289,16973825,17104897,17170433,17235969,17301505,17367041,17432577,17563649,17694721,17825793,17891329,18022401,18087937,18153473,18219009,18284545,18350081,18481153,18546689,18612225,18677761,18743297,18808833,18874369,18939905,19005441,19136513,19267585,19333121,19464193,19529729,19595265,19660801,19726337,19791874,19922945,19988481,20054017,20119553,20185089,20250625,20316161,20381697,20447233,20512769,20643841,20709377,20774913,20905985,21037057,21102593,21168129,21233665,21364737,21430273,21495809,21561345,21692417,21823489,21889025,21954561,22020097,22085633,22216705,22282241,22347777,22413313,22478849,22544385,22609921,22675457,22740993,22806529,22872065,22937601,23003137],"valid":[3211265,5963777,7340033,20316161,20447233],"visit":[3473409,7405569,18284545],"var":[917506,3080195,3801090,4980737,6094851,6356994,6422529,6881285,8912897,9830402,10092546,10223617,10354690,10682371,11599874,11730948,12582917,13041667,13303811,14090242,15138818,15204355,16318465,17825793,18153474,18612228,19922946,19988482,20709377,21233666,22347777],"variables":[11141121,12779521,20185089],"visual":[589826,720898,917506,1114114,1179650,1310722,1376258,1835010,1966082,2031618,2097154,2424834,2818050,2883586,3014658,3080194,3735554,3801090,3997698,4259842,4390914,4521986,4587522,4653058,4784130,4980738,5177346,5242882,5439490,5701634,5767170,6029314,6094850,6160386,6291458,6356994,6422530,6619138,6815746,6881282,6946818,7274498,7536642,7602178,7667714,7798786,8257538,8388610,8912898,9043970,9175042,9502722,9568258,9830402,9895938,9961474,10092546,10223618,10354690,10682370,10813442,10944514,11010050,11075586,11272194,11337730,11468802,11599874,11665410,11730946,11862018,11993090,12058626,12255234,12320770,12582914,12976130,13041666,13107202,13172738,13303810,13369346,13631490,13697026,13762562,13893634,13959170,14090242,14155778,14221314,14286850,14417922,14483458,14745602,14876674,15073282,15138818,15204354,15269890,15597570,15794178,15859714,15925250,16318466,16384002,16449538,16515074,16580610,16646146,16973826,17104898,17301506,17367042,17432578,17629185,17825794,17891330,18022402,18087938,18153474,18219010,18350082,18546690,18612226,18743298,18874370,18939906,19005442,19136514,19529730,19922946,19988482,20054018,20119554,20250626,20381698,20643842,20709378,20774914,20905986,21168130,21233666,21430274,21495810,21823490,21889026,21954562,22085634,22282242,22347778,22413314,22478850,22544386,22675458,23003137],"values":[786435,851971,983043,1638401,1835010,2686979,3080194,3801089,4915203,4980737,5111810,5636099,6881281,7995393,8192003,8323081,8912897,9830401,10223617,10878980,10944515,11730946,12582913,12910595,13041666,13238275,13631490,14483457,15925250,16187395,16318465,16842755,17694723,18612226,18808834,19726339,19988481,20709377,21037059,21364739,21954562,22347777,22478849,22609923,23003145],"virtual":[1638401,7733249,7995393,17170433],"value":[262145,393218,458753,524289,589825,720898,917507,983041,1048577,1114113,1179650,1310721,1376258,1507330,1638403,1835009,1900547,1966082,2031617,2097154,2359300,2424834,2555905,2621441,2686977,2818049,2883585,3014658,3080193,3276801,3604481,3670019,3735553,3801089,3866628,3997698,4063233,4194306,4259842,4325377,4390913,4521985,4587522,4653057,4784129,4849667,4915201,4980737,5111813,5177346,5242881,5373961,5439490,5570561,5636097,5701633,5767169,5963785,6029313,6094849,6160386,6291458,6356993,6422529,6488068,6553601,6619137,6684674,6815746,6881281,6946817,7012353,7077891,7143425,7274497,7340041,7405569,7536642,7602177,7667713,7733249,7798785,7995399,8060931,8126473,8192001,8257537,8323095,8388609,8519681,8650753,8912897,9043969,9109506,9175041,9306114,9371650,9502721,9568258,9633793,9699329,9764867,9830401,9895937,9961474,10092545,10223617,10289153,10354691,10616834,10682369,10813441,10944513,11010050,11075586,11141121,11206657,11272194,11337729,11468801,11599874,11665409,11730945,11796482,11862017,11927553,11993090,12058625,12124161,12255234,12320769,12386307,12517377,12582913,12648449,12779521,12845057,12910593,12976129,13041665,13107201,13172737,13238273,13303809,13369345,13500417,13631489,13697025,13762562,13893634,13959170,14024705,14090241,14155777,14221313,14286850,14417921,14483457,14548993,14745601,14811137,14876673,14942209,15073281,15138818,15204353,15269889,15335428,15400961,15532033,15597569,15794177,15859713,15925249,15990785,16187393,16252932,16318465,16384001,16449537,16515073,16580609,16646145,16711681,16777219,16842753,16973825,17104897,17170433,17235969,17301505,17367041,17432577,17498115,17694721,17825793,17891329,17956870,18022401,18087938,18153473,18219009,18350081,18481153,18546689,18612225,18677762,18743297,18808837,18874369,18939905,19005441,19136515,19267587,19333121,19529729,19660809,19726337,19791875,19922947,19988481,20054018,20119553,20185090,20250625,20316162,20381698,20447236,20512769,20643841,20709377,20774914,20840452,20905985,21037057,21168129,21233667,21364737,21430273,21495809,21626881,21692417,21823490,21889026,21954561,22085633,22216705,22282241,22347777,22413313,22478849,22544386,22609921,22675460,22740993,22872073,23003159],"void":[589845,851971,1441794,2162691,2490371,2883593,4653077,5242891,5505025,6488065,7208963,7667720,7798794,7929860,8192011,8323091,8847363,9175050,10878978,11534339,11665416,11862043,13369354,13565955,14417941,14745611,14876682,15466499,15597593,16056323,16252929,16384008,18022407,19202049,19398659,19726347,20119562,20643847,21037066,21299203,21430280,21495818,22806531,23003155,23068673]}
\ No newline at end of file
diff --git a/docs/fti/FTI_119.json b/docs/fti/FTI_119.json
deleted file mode 100644
index 9bda8e2c9..000000000
--- a/docs/fti/FTI_119.json
+++ /dev/null
@@ -1 +0,0 @@
-{"way":[655361,720897,917505,1376257,1835010,2031617,2097153,2424833,3014657,3080193,3801089,4259841,4390913,4587521,4784129,4980737,5767169,6094849,6160385,6291457,6356993,6881281,6946817,7602177,8257537,8388609,8912897,9699329,10092545,10223617,10354689,10420225,10682369,10813441,11010049,11075585,11141121,11272193,11337729,11599873,11730945,12058625,12189697,12320769,12582913,12779521,13041665,13107201,13303809,13631490,13762561,13893633,13959169,14090241,14155777,14221313,14286849,15138817,15204353,15925250,16318465,16449537,16973825,17301505,17432577,17891329,18087937,18153473,18350081,18546689,18612225,18939905,19988481,20054017,20185089,20905985,21102593,21954562,22282241,22413313],"write":[11141121,12779521,20185089],"writeline":[1638401,20185089],"work":[983041,2686977,4915201,5636097,8847366,12910593,13238273,13565958,16056326,16187393,16842753,17694721,21364737,22609921],"web":[19070977],"waiting":[1376257,2818049,4521985,4587521,5439489,5701633,6029313,6160385,6291457,7536641,7602177,8388609,11075585,11993089,12255233,12976129,13959169,14155777,15269889,16580609,17301505,17432577,18350081,18546689,18743297,20381697,21889025,22282241],"want":[17629185,18284545]}
\ No newline at end of file
diff --git a/docs/fti/FTI_122.json b/docs/fti/FTI_122.json
deleted file mode 100644
index 2416eb864..000000000
--- a/docs/fti/FTI_122.json
+++ /dev/null
@@ -1 +0,0 @@
-{"zero":[720897,917505,983041,1376257,1835010,2031617,2097153,2424833,2686977,3014657,3080193,3801089,4259841,4390913,4587521,4784129,4915201,4980737,5636097,5767169,6094849,6160385,6291457,6356993,6881281,6946817,7602177,8257537,8388609,8912897,10092545,10223617,10354689,10682369,10813441,11010049,11075585,11272193,11337729,11599873,11730945,12058625,12320769,12582913,12910593,13041665,13107201,13238273,13303809,13631490,13762561,13893633,13959169,14090241,14155777,14221313,14286849,15138817,15204353,15925250,16187393,16318465,16449537,16842753,16973825,17301505,17432577,17694721,17891329,18087937,18153473,18350081,18546689,18612225,18939905,19988481,20054017,20709377,20905985,21364737,21954562,22282241,22347777,22413313,22609921]}
\ No newline at end of file
diff --git a/docs/fti/FTI_95.json b/docs/fti/FTI_95.json
deleted file mode 100644
index 2515c47e2..000000000
--- a/docs/fti/FTI_95.json
+++ /dev/null
@@ -1 +0,0 @@
-{"_exception":[5505025,13500417]}
\ No newline at end of file
diff --git a/docs/fti/FTI_97.json b/docs/fti/FTI_97.json
deleted file mode 100644
index 66189d1d3..000000000
--- a/docs/fti/FTI_97.json
+++ /dev/null
@@ -1 +0,0 @@
-{"affect":[5963777,7340033,20316161],"arecontextkeywordsenabled":[5963777,7340033,20316162],"asenumerable":[8323073,9895938,23003137],"administrator":[19857409],"automatic":[14548993,21626881],"annotated":[655361,9699329,10420225,12189697,21102593],"average":[1179649],"await":[720897,1376257,2097153,2818049,4259841,4521985,4587521,5439489,5701633,5767169,6029313,6160385,6291457,7536641,7602177,8257537,8388609,10813441,11010049,11075585,11337729,11993089,12058625,12255233,12976129,13959169,14155777,14286849,15269889,16580609,17301505,17432577,18350081,18546689,18743297,18939905,20054017,20381697,20905985,21889025,22282241,22413313],"apply":[1835010,3801089,4980737,8912897,10223617,13631490,15925250,16318465,19988481,20709377,21954562,22347777],"abc":[6881282,12582914],"address":[19070977],"accessor":[1507330,5963778,7340034],"application":[393217,524289,655362,2949121,3211265,3932161,5308418,6750210,9306113,10420228,10551298,11141124,12189701,12517377,12779524,14942209,15532033,16711682,17629185,18481153,19464194,20185092,21102594,22740993,22937602],"active":[720897,1376257,2097153,2818049,4259841,4521985,4587521,5439489,5701633,5767169,6029313,6160385,6291457,7536641,7602177,8257537,8388609,10813441,11010049,11075585,11337729,11993089,12058625,12255233,12976129,13959169,14155777,14286849,15269889,16580609,17301505,17432577,18350081,18546689,18743297,18939905,20054017,20381697,20905985,21889025,22282241,22413313],"activator":[20185089],"asynchronous":[720898,1376258,2097154,2818050,4259842,4521986,4587522,5439490,5701634,5767170,6029314,6160386,6291458,7536642,7602178,8257538,8388610,10813442,11010050,11075586,11337730,11993090,12058626,12255234,12976130,13959170,14155778,14286850,15269890,16580610,17301506,17432578,18350082,18546690,18743298,18939906,20054018,20381698,20905986,21889026,22282242,22413314],"anonymous":[5963777,7340033,12386305,12779521,17629185],"access":[1507329,5963777,7340033],"appdomain":[3211265,12189697],"added":[17629185,18808833],"albert":[20185089],"according":[917505,2162690,2490370,3080194,5177345,6815745,8060931,8323085,10354689,11599873,11730946,13041666,15138817,17956870,18612226,19922945,21233665,22544385,23003149],"assigned":[393217,7995393,9306113],"allows":[655361,1769473,2752513,3145729,3342337,4194305,4718593,5963777,7012353,7340034,7471105,8585217,10420225,10485761,11206657,12189697,12713985,16121857,16908289,17039361,17629185,18284545,19595265,19660801,21102593,21757953,22872065,23003137],"anyasync":[4456452,5373955,7602179,8126467,8257539,12976131,14155779,15269891,18415620,18939907,19660803,22872067],"array":[720897,917505,983042,1114115,1376257,1835010,2031617,2097153,2424833,2686978,3014657,3080193,3801089,4259841,4390913,4587521,4784129,4915202,4980737,5636097,5767169,6094849,6160385,6291457,6356993,6881281,6946817,7208963,7274499,7602177,8257537,8388609,8912897,10092545,10158083,10223617,10354689,10682369,10813441,11010049,11075585,11272193,11337729,11599873,11730945,12058625,12320769,12582913,12910593,13041665,13107201,13172739,13238273,13303809,13631490,13762561,13893633,13959169,14090241,14155777,14221313,14286849,15138817,15204353,15466499,15663107,15859715,15925250,16187393,16318465,16449537,16515075,16711681,16842753,16973825,17301505,17367043,17432577,17694722,17891329,18087937,18153473,18350081,18546689,18612225,18939905,19398659,19988481,20054017,20709377,20905985,21364737,21954562,22282241,22347777,22413313,22609921,22806531],"args":[589827,720898,917506,1376258,2031618,2097154,2424834,3014658,3080194,3801090,4259842,4390914,4587522,4653059,4784130,4980738,5242883,5767170,6094850,6160386,6291458,6356994,6881282,6946818,7602178,7798787,8257538,8388610,8912898,9175043,10092546,10223618,10354690,10682370,10813442,11010050,11075586,11272194,11337730,11599874,11730946,11862019,12058626,12320770,12582914,13041666,13107202,13303810,13369347,13762562,13893634,13959170,14090242,14155778,14221314,14286850,14417923,14745603,14876675,15138818,15204354,15597571,16318466,16449538,16973826,17301506,17432578,17891330,18087938,18153474,18350082,18546690,18612226,18939906,19988482,20054018,20709378,20905986,21495811,22282242,22347778,22413314],"aspx":[1572867,4259841,4521985,5373958,5701633,6291457,8126470,8388609,10813441,11075585,11337729,11993089,12255233,15007747,16777219,17498115,19660806,20054017,22282241,22872070],"assign":[1638401],"abstractdynamiclinqcustomtypeprovider":[196612,524290,655363,2555906,3211265,5308417,9699330,10420228,10551297,12189702,12517378,21102598],"associated":[393217,9306113],"async":[1114113,1769474,7274497,10158083,13172737,15466499,17629185,19660801,21757954,22806532,22872065],"assemblies":[524291,2555907,2949121,5963777,7340033,9371649,9699331,12517379,13828097,16711682,17629185,19464194],"adds":[1769473,3211265,12189697,21757953],"aggregate":[1179653,8323074,23003138],"asqueryable":[6094849,6356993,6422529,9830401,10092545,10682369,13303809,14090241,15204353,17825793,18153473],"accessors":[11141121,12779521,20185089],"available":[4194305,5963777,7340033,14548993,19070977,21626881],"additional":[393217,9306113],"articles":[5963777,7340033,14811137],"attribute":[3866628,10027010,20447240],"add":[3473409,7405569,18284545],"assembly":[196609,393217,458753,524291,589825,655361,720897,786433,917505,983041,1048577,1114113,1179649,1245185,1310721,1376257,1507329,1638401,1703937,1835009,1966081,2031617,2097153,2424833,2555907,2621441,2686977,2818049,2883585,3014657,3080193,3276801,3342337,3538945,3604481,3735553,3801089,3932161,3997697,4063233,4194305,4259841,4325377,4390913,4521985,4587521,4653057,4784129,4849665,4915201,4980737,5177345,5242881,5308417,5439489,5505025,5636097,5701633,5767169,5832705,6029313,6094849,6160385,6225921,6291457,6356993,6422529,6488065,6619137,6815745,6881281,6946817,7012353,7143425,7208961,7274497,7340033,7405569,7536641,7602177,7667713,7733249,7798785,7995393,8192001,8257537,8388609,8519681,8650753,8716289,8912897,8978433,9043969,9109505,9175041,9371649,9437185,9502721,9568257,9633793,9699332,9830401,9895937,9961473,10092545,10223617,10289153,10354689,10420227,10485761,10551297,10682369,10747905,10813441,10944513,11010049,11075585,11141121,11206657,11272193,11337729,11468801,11599873,11665409,11730945,11796481,11862017,11927553,11993089,12058625,12124161,12189700,12255233,12320769,12386305,12517379,12582913,12648449,12779522,12845057,12910593,12976129,13041665,13107201,13172737,13238273,13303809,13369345,13500417,13565953,13631489,13697025,13762561,13893633,13959169,14024705,14090241,14155777,14221313,14286849,14417921,14483457,14548993,14745601,14811137,14876673,14942209,15073281,15138817,15204353,15269889,15400961,15532033,15597569,15794177,15859713,15925249,15990785,16187393,16252929,16318465,16384001,16449537,16515073,16580609,16646145,16711683,16842753,16908289,16973825,17104897,17170433,17235969,17301505,17367041,17432577,17563649,17629185,17694721,17825793,17891329,18022401,18087937,18153473,18219009,18284545,18350081,18481153,18546689,18612225,18677761,18743297,18808833,18874369,18939905,19005441,19136513,19267585,19333121,19464193,19529729,19595265,19660801,19726337,19791873,19922945,19988481,20054017,20119553,20185090,20250625,20316161,20381697,20447233,20512769,20643841,20709377,20774913,20905985,21037057,21102594,21168129,21233665,21364737,21430273,21495809,21561345,21692417,21823489,21889025,21954561,22020097,22085633,22216705,22282241,22347777,22413313,22478849,22544385,22609921,22675457,22740993,22806529,22872065,22937601,23003137],"addition":[17629185,18808833],"automatically":[1,11141121,12779521,20185089],"allownewtoevaluateanytype":[4194306,5963777,7340033],"asynchronously":[720897,1376257,1572867,1900547,2097153,2818049,3407875,3670019,4259841,4456451,4521985,4587521,5373973,5439489,5701633,5767169,6029313,6160385,6291457,7077891,7536641,7602177,7864323,8126485,8257537,8388609,9764867,10813441,11010049,11075585,11337729,11993089,12058625,12255233,12451843,12976129,13959169,14155777,14286849,15007747,15269889,16580609,16777219,17301505,17432577,17498115,18350081,18415619,18546689,18743297,18939905,19660821,20054017,20381697,20905985,21889025,22151171,22282241,22413313,22872085],"ascending":[2162690,2490370,3080193,8323076,11730945,13041665,18612225,23003140],"abstract":[3211265,18808833,21102594]}
\ No newline at end of file
diff --git a/docs/fti/FTI_98.json b/docs/fti/FTI_98.json
deleted file mode 100644
index b09c16702..000000000
--- a/docs/fti/FTI_98.json
+++ /dev/null
@@ -1 +0,0 @@
-{"boolean":[458753,983042,1507329,1638401,3932161,4194305,4915202,5636098,6094849,7602177,7995393,8192010,8257537,8847368,9371649,9633794,11796481,12386305,12976129,13238274,13565960,13697025,14155777,14811137,15204353,15269889,15990785,16056328,16187394,17825793,18939905,19726346,19791873,20185089,20316161,21037065,21692417],"basic":[589826,720898,917506,1114114,1179650,1310722,1376258,1835010,1966082,2031618,2097154,2424834,2818050,2883586,3014658,3080194,3735554,3801090,3997698,4259842,4390914,4521986,4587522,4653058,4784130,4980738,5177346,5242882,5439490,5701634,5767170,6029314,6094850,6160386,6291458,6356994,6422530,6619138,6815746,6881282,6946818,7274498,7536642,7602178,7667714,7798786,8257538,8388610,8912898,9043970,9175042,9502722,9568258,9830402,9895938,9961474,10092546,10223618,10354690,10682370,10813442,10944514,11010050,11075586,11272194,11337730,11468802,11599874,11665410,11730946,11862018,11993090,12058626,12255234,12320770,12582914,12976130,13041666,13107202,13172738,13303810,13369346,13631490,13697026,13762562,13893634,13959170,14090242,14155778,14221314,14286850,14417922,14483458,14745602,14876674,15073282,15138818,15204354,15269890,15597570,15794178,15859714,15925250,16318466,16384002,16449538,16515074,16580610,16646146,16973826,17104898,17301506,17367042,17432578,17629185,17825794,17891330,18022402,18087938,18153474,18219010,18350082,18546690,18612226,18743298,18874370,18939906,19005442,19136514,19529730,19922946,19988482,20054018,20119554,20250626,20381698,20643842,20709378,20774914,20905986,21168130,21233666,21430274,21495810,21823490,21889026,21954562,22085634,22282242,22347778,22413314,22478850,22544386,22675458,23003137],"bb738550":[1572867,4259841,4521985,5373958,5701633,6291457,8126470,8388609,10813441,11075585,11337729,11993089,12255233,15007747,16777219,17498115,19660806,20054017,22282241,22872070],"based":[851971,1310721,1507329,1769473,2031617,4784129,5898242,5963777,6881281,6946817,7340033,7929858,8323082,12582913,12779521,14483457,14680067,16646145,17629186,17891329,19660801,21757953,22085633,22872065,23003147],"box":[19070977],"bool":[458753,983041,1507329,1638401,3932161,4194305,4915201,5636097,6094849,7602177,7995393,8192001,8257537,9371649,9633794,11796481,12386305,12976129,13238273,13697025,14155777,14811137,15204353,15269889,15990785,16187393,17825793,18939905,19726337,19791873,20185089,20316161,21037057,21692417],"behavior":[1638402,5111810,7995394,18808834],"base":[17629185,18808833],"binder":[1638406,7995398],"bypasses":[6356993,8323075,10092545,13434882,18219009,23003139],"blob":[5963777,7340033,14811137],"behaviour":[1507329,5963777,7340033],"birthday":[20185090]}
\ No newline at end of file
diff --git a/docs/fti/FTI_99.json b/docs/fti/FTI_99.json
deleted file mode 100644
index 5ad5af6ed..000000000
--- a/docs/fti/FTI_99.json
+++ /dev/null
@@ -1 +0,0 @@
-{"constructor":[196609,786433,983041,1245185,1703937,2686977,3538945,3932161,4915201,5636097,5832705,6225921,8716289,8847366,9437185,10747905,12910593,13238273,13565958,16056326,16187393,16842753,17563649,17629186,17694721,18808834,20185089,21364737,21561345,22609921],"cases":[1638401,7995393],"contextual":[5505025],"comparer":[2031617,4784129,5898242,6946817,7929858,8323077,9830401,17891329,23003141],"collectionparameter":[13631489,21954561],"category":[1441794,8323074,20709377,22347777,23003138],"code":[3866625,20447233],"core":[65537,131074,196613,262146,327682,393222,458757,524293,589836,655362,720897,786438,851970,917510,983045,1048581,1114117,1179653,1245189,1310725,1376257,1441794,1507333,1572865,1638405,1703941,1769473,1835013,1900545,1966085,2031622,2097153,2162690,2228225,2293762,2359298,2424837,2490370,2555909,2621445,2686982,2752514,2818049,2883595,2949122,3014662,3080197,3145730,3211268,3276805,3342343,3407873,3473410,3538949,3604485,3670017,3735558,3801093,3866626,3932165,3997701,4063237,4128770,4194309,4259841,4325381,4390917,4456449,4521985,4587521,4653068,4718594,4784133,4849669,4915206,4980742,5046274,5111810,5177350,5242900,5308418,5373953,5439489,5505029,5570562,5636101,5701633,5767169,5832709,5898242,5963781,6029313,6094854,6160385,6225925,6291457,6356997,6422533,6488069,6553602,6619141,6684674,6750211,6815749,6881285,6946821,7012358,7077889,7143429,7208966,7274501,7340042,7405573,7471106,7536641,7602177,7667721,7733254,7798795,7864321,7929858,7995397,8060930,8126465,8192022,8257537,8323074,8388609,8454146,8519685,8585218,8650757,8716293,8781826,8847362,8912901,8978437,9043973,9109509,9175051,9240578,9306114,9371653,9437189,9502725,9568261,9633797,9699333,9764865,9830405,9895941,9961477,10027010,10092550,10158082,10223622,10289157,10354693,10420227,10485767,10551298,10616834,10682373,10747909,10813441,10878978,10944517,11010049,11075585,11141122,11206662,11272197,11337729,11403266,11468805,11534338,11599877,11665417,11730950,11796485,11862042,11927557,11993089,12058625,12124165,12189705,12255233,12320774,12386309,12451841,12517381,12582918,12648454,12713986,12779526,12845061,12910597,12976129,13041670,13107205,13172741,13238278,13303814,13369355,13434882,13500421,13565958,13631493,13697029,13762565,13828097,13893638,13959169,14024710,14090245,14155777,14221318,14286849,14352386,14417932,14483461,14548997,14614530,14680066,14745620,14811141,14876683,14942213,15007745,15073285,15138822,15204357,15269889,15335426,15400965,15466498,15532037,15597582,15663106,15728642,15794181,15859717,15925254,15990789,16056322,16121858,16187398,16252933,16318469,16384009,16449542,16515077,16580609,16646149,16711685,16777217,16842757,16908295,16973829,17039362,17104901,17170437,17235973,17301505,17367045,17432577,17498113,17563653,17629188,17694725,17760258,17825797,17891334,17956866,18022408,18087942,18153478,18219013,18284550,18350081,18415617,18481157,18546689,18612229,18677765,18743297,18808838,18874373,18939905,19005445,19070977,19136517,19202050,19267589,19333125,19398658,19464197,19529733,19595270,19660801,19726358,19791879,19857409,19922949,19988486,20054017,20119563,20185093,20250629,20316165,20381697,20447238,20512773,20578306,20643848,20709382,20774917,20840450,20905985,20971522,21037076,21102600,21168133,21233670,21299202,21364742,21430281,21495819,21561349,21626883,21692421,21757953,21823493,21889025,21954566,22020099,22085638,22151169,22216709,22282241,22347781,22413313,22478853,22544389,22609926,22675461,22740997,22806534,22872065,22937606,23003142,23068674],"causes":[393217,9306113],"compare":[2031617,4784129,5898242,6946817,7929858,8323077,9830401,17891329,23003141],"customtypeprovider":[5963778,7340034,9371649,10289154],"correlates":[2031617,4784129,5898242,6946817,7929858,8323076,17891329,23003140],"console":[1638401,20185089],"createinstance":[20185089],"condition":[131075,327682,720898,1376260,1572866,1900550,2097154,2359299,2424834,3014658,3407874,3670018,3997697,4259842,4390914,4456450,4587522,5373970,5439491,5767171,6094849,6160386,6291458,6356994,6881282,7077894,7536643,7602179,7864322,8126482,8257539,8323094,8388610,8781827,9043969,9502721,9568257,9764866,9961473,10092546,10682370,10813442,11010052,11075586,11272194,11337730,11403267,12058627,12320770,12451842,12582914,13107202,13303810,13434882,13762562,13893634,13959172,14090242,14155779,14221314,14286852,14483457,15007746,15204353,15335427,15794177,16449538,16777218,16973826,17104897,17301506,17432578,17498114,18087938,18153474,18350083,18415618,18546691,18939907,19660818,20054018,20840451,20905986,22151170,22282242,22413314,22872082,23003158],"convert":[3735553,9633793,11468801,13565953,17629185,18874369],"combines":[4980737,8323076,8912897,10223617,10878980,16318465,23003140],"cached":[3997697,9043969,9502721,9568257,9961473,13697025,14483457,15794177,17104897],"class":[131073,196610,262145,327681,393221,458753,524289,589825,655361,720897,786434,851969,917505,983041,1048577,1114113,1179649,1245186,1310721,1376257,1441795,1507329,1572865,1638404,1703938,1769473,1835009,1900545,1966081,2031617,2097153,2162689,2293761,2359297,2424833,2490369,2555905,2621441,2686977,2752513,2818049,2883585,3014657,3080193,3145729,3211266,3276801,3342339,3407873,3473409,3538946,3604481,3670017,3735553,3801089,3866628,3932162,3997697,4063233,4128769,4194305,4259841,4325377,4390913,4456449,4521985,4587521,4653057,4718593,4784129,4849665,4915201,4980737,5046273,5111811,5177345,5242881,5308417,5373953,5439489,5505026,5570561,5636098,5701633,5767169,5832706,5898241,5963778,6029313,6094849,6160385,6225922,6291457,6356993,6422529,6488065,6553601,6619137,6684673,6815745,6881281,6946817,7012355,7077889,7143425,7208962,7274497,7340037,7405569,7471105,7536641,7602177,7667713,7733249,7798785,7864321,7929857,7995398,8060929,8126465,8192001,8257537,8323075,8388609,8454145,8519681,8585217,8650753,8716290,8781825,8847361,8912897,9043969,9109505,9175041,9240577,9306113,9371649,9437186,9502721,9568257,9699329,9764865,9830401,9895937,9961473,10027010,10092545,10158081,10223617,10289153,10354689,10420225,10485763,10551297,10616833,10682369,10747906,10813441,10878977,10944513,11010049,11075585,11141127,11206659,11272193,11337729,11403265,11468801,11534337,11599873,11665409,11730945,11796481,11862017,11927553,11993089,12058625,12124161,12189700,12255233,12320769,12386306,12451841,12517377,12582913,12713985,12779528,12845057,12910594,12976129,13041665,13107201,13172737,13238273,13303809,13369345,13434881,13500417,13565955,13631489,13697025,13762561,13828098,13893633,13959169,14024705,14090241,14155777,14221313,14286849,14417921,14483457,14614529,14680065,14745601,14811137,14876673,15007745,15073281,15138817,15204353,15269889,15335425,15400961,15466497,15597569,15663105,15728641,15794177,15859713,15925249,15990785,16056321,16121857,16187394,16252929,16318465,16384001,16449537,16515073,16580609,16646145,16777217,16842753,16908291,16973825,17039361,17104897,17170433,17235969,17301505,17367041,17432577,17498113,17563650,17629188,17694721,17760259,17825793,17891329,17956865,18022401,18087937,18153473,18219009,18284547,18350081,18415617,18481153,18546689,18612225,18677761,18743297,18808838,18874369,18939905,19005441,19136513,19202049,19267585,19333121,19398657,19529729,19595267,19660802,19726337,19791873,19922945,19988481,20054017,20119553,20185095,20250625,20316161,20381697,20447239,20512769,20643841,20709378,20774913,20840449,20905985,20971521,21037057,21102595,21168129,21233665,21299201,21364738,21430273,21495809,21561346,21626881,21757953,21823489,21889025,21954561,22085633,22151169,22216705,22282241,22347778,22413313,22478849,22544385,22609921,22675457,22740993,22806530,22872066,23003140,23068673],"collectionselectorargs":[1835010,13631490,15925250,21954562],"config":[589827,917506,2031618,3014658,3735554,4653059,4980738,5177346,5242883,6094850,10092546,10223618,11730946,11862019,12320770,12582914,13041666,13303810,13893634,14221314,14417923,14745603,15138818,15925250,16449538,17891330,18087938,18153474,19988482,20709378,21233666,21954562,22085634],"contain":[19070977],"coded":[393217,9306113],"caused":[393217,9306113],"components":[1769473,17629185,19660801,21757953,22872065,23003137],"cache":[3932161],"countasync":[3407876,5373955,5767171,6029315,7864324,8126467,12058627,18350083,18546691,18743299,19660803,22872067],"caution":[5963777,7340033,9371649],"correspond":[22478849],"converts":[3735553,8323075,8454147,11468801,18874369,23003139],"common":[2228225,22020097],"collection":[393217,655361,1310721,2031617,2228225,2752513,3145729,3342337,4718593,6946817,7012353,7340033,7471105,8323074,8585217,9306113,10420225,10485761,10616834,11206657,12189697,12713985,16121857,16646145,16908289,17039361,18284545,19136513,19595265,21102593,22020097,22085633,22675457,23003138],"customtypes":[3932161],"configuration":[786433,2686977,4915201,7340033,13238273,16187393,17629185,21364737,22609921],"collections":[524289,1114113,2031617,2555905,4784129,5177345,6815745,6946817,7274497,9699329,11862027,12517377,13172737,15597578,15859713,16515073,17367041,17891329,20185089,22544385],"creates":[393217,655361,917505,1114113,2752513,3145729,3342337,4718593,5177345,6815745,7012353,7208963,7274497,7340033,7471105,8060931,8323081,8585217,10158083,10354689,10420225,10485761,11141121,11206657,11599873,12189697,12713985,12779521,13172737,13500417,15138817,15466499,15663107,15859713,16121857,16515073,16908289,17039361,17367041,17760257,17956870,18284545,19398659,19595265,19922945,20185089,21102593,21233665,22544385,22806531,23003145],"created":[11141125,12779525,20185093],"ctor":[458753],"contiguous":[8323073,19005441,23003137],"combined":[1835009,8323076,10878980,13631489,15925249,21954561,23003140],"call":[393217,589826,720898,917506,1114114,1179650,1310722,1376258,1835010,1966082,2031618,2097154,2424834,2818050,2883586,3014658,3080194,3735554,3801090,3997698,4259842,4390914,4521986,4587522,4653058,4784130,4980738,5177346,5242882,5439490,5701634,5767170,6029314,6094850,6160386,6291458,6356994,6422530,6619138,6815746,6881282,6946818,7012353,7274498,7536642,7602178,7667714,7798786,8257538,8388610,8912898,9043970,9175042,9306113,9502722,9568258,9830402,9895938,9961474,10092546,10223618,10354690,10682370,10813442,10944514,11010050,11075586,11272194,11337730,11468802,11599874,11665410,11730946,11862018,11993090,12058626,12255234,12320770,12582914,12976130,13041666,13107202,13172738,13303810,13369346,13631490,13697026,13762562,13893634,13959170,14090242,14155778,14221314,14286850,14417922,14483458,14745602,14876674,15073282,15138818,15204354,15269890,15597570,15794178,15859714,15925250,16318466,16384002,16449538,16515074,16580610,16646146,16973826,17104898,17301506,17367042,17432578,17629185,17825794,17891330,18022402,18087938,18153474,18219010,18350082,18546690,18612226,18743298,18874370,18939906,19005442,19136514,19529730,19922946,19988482,20054018,20119554,20250626,20381698,20643842,20709378,20774914,20905986,21168130,21233666,21430274,21495810,21823490,21889026,21954562,22085634,22282242,22347778,22413314,22478850,22544386,22675458],"considered":[11141121,12779521,20185089],"context":[720898,1376258,2097154,2818050,2949121,4259842,4521986,4587522,5439490,5505026,5701634,5767170,5963778,6029314,6160386,6291458,7340034,7536642,7602178,8257538,8388610,10813442,11010050,11075586,11337730,11993090,12058626,12255234,12976130,13959170,14155778,14286850,15269890,16580610,16711681,17301506,17432578,17629185,18350082,18546690,18743298,18939906,19464194,20054018,20316162,20381698,20905986,21889026,22282242,22413314],"create":[458753,983041,1114113,2031617,2686977,4784129,4915201,5636097,6946817,7274497,8847366,11141121,12779522,12910593,13172737,13238273,13565958,15859713,16056326,16187393,16515073,16842753,17367041,17629185,17694721,17891329,20185090,21364737,22609921],"com":[1572867,4259841,4521985,5373958,5701633,5963778,6291457,7340034,8126470,8388609,10813441,11075585,11337729,11993089,12255233,12779521,14811137,15007747,16777219,17498115,17629185,19660806,19791873,20054017,22282241,22872070],"case":[1638401,7995393],"counted":[5767169,6029313,6422529,9043969,10682369,12058625,13303809,18350081,18546689,18743297],"converted":[3735554,11468802,18874370],"complete":[1376257,2818049,4521985,4587521,5439489,5701633,6029313,6160385,6291457,7536641,7602177,8388609,11075585,11993089,12255233,12976129,13959169,14155777,15269889,16580609,17301505,17432577,18350081,18546689,18743297,20381697,21889025,22282241],"computes":[8323073,10944513,23003137],"constructors":[393217,3342337,7012353,7340033,10485761,11206657,12189697,16908289,18284545,18808833,19595265,20447233,21102593],"currently":[11141121,12779521,20185089],"calculate":[10944513],"cleanup":[655361,2752513,3145729,3342337,4718593,7012353,7340033,7471105,8585217,10420225,10485761,11206657,12189697,12713985,16121857,16908289,17039361,18284545,19595265,21102593],"convertexpr":[9633794],"called":[1638402,7995393],"collectionparametername":[13631490,21954562],"cachecustomtypes":[3932162],"compile":[1769473,17629185,19660801,21757953,22872065,23003137],"consider":[3211265,20447233],"custom":[3211269,6750209,7733250,10420225,12189698,12648450,21102593,22937602],"cast":[1114113,3735555,8323075,8454148,11468803,15859713,18874371,23003139],"calling":[720897,1376257,2097153,2818049,4259841,4521985,4587521,5439489,5701633,5767169,6029313,6160385,6291457,7536641,7602177,8257537,8388609,10813441,11010049,11075585,11337729,11993089,12058625,12255233,12976129,13959169,14155777,14286849,15269889,16580609,17301505,17432577,18350081,18546689,18743297,18939905,20054017,20381697,20905985,21889025,22282241,22413313],"classes":[1638401,1769473,3211265,5046273,5111810,7995393,11141125,12779526,17629186,18808834,20185093,21626881,21757953],"check":[6094849,6356993,10092545,12976129,13697025,14090241,15204353,15269889,15990786,17825793,18153473,19070977,21692418],"cancellationtoken":[1376262,1572866,1900546,2818054,3407874,3670018,4456450,4521990,4587526,5373966,5439494,5701638,6029318,6160390,6291462,7077890,7536646,7602182,7864322,8126478,8388614,9764866,11075590,11993094,12255238,12451842,12976134,13959174,14155782,15007746,15269894,16580614,16777218,17301510,17432582,17498114,18350086,18415618,18546694,18743302,19660814,20381702,21889030,22151170,22282246,22872078],"copy":[196609,393217,458753,524289,589825,655361,720897,786433,917506,983041,1048577,1114113,1179649,1245185,1310721,1376257,1507329,1638401,1703937,1835010,1966081,2031617,2097153,2424833,2555905,2621441,2686977,2752513,2818049,2883585,3014657,3080194,3145729,3276801,3342338,3538945,3604481,3735553,3801090,3932161,3997697,4063233,4194305,4259841,4325377,4390913,4521985,4587521,4653057,4718593,4784129,4849665,4915201,4980738,5177345,5242881,5439489,5505025,5636097,5701633,5767169,5832705,6029313,6094850,6160385,6225921,6291457,6356994,6422530,6488065,6619137,6815745,6881282,6946817,7012354,7143425,7208961,7274497,7340034,7405569,7471105,7536641,7602177,7667713,7733249,7798785,7995393,8192001,8257537,8388609,8519681,8585217,8650753,8716289,8912898,8978433,9043969,9109505,9175041,9371649,9437185,9502721,9568257,9633793,9699329,9830402,9895937,9961473,10092546,10223618,10289153,10354690,10420225,10485762,10682370,10747905,10813441,10944513,11010049,11075585,11206658,11272193,11337729,11468801,11599874,11665409,11730946,11796481,11862017,11927553,11993089,12058625,12124161,12189698,12255233,12320769,12386305,12517377,12582914,12648449,12713985,12779521,12845057,12910593,12976129,13041666,13107201,13172737,13238273,13303810,13369345,13500417,13565953,13631490,13697025,13762561,13828097,13893633,13959169,14024705,14090242,14155777,14221313,14286849,14417921,14483457,14548993,14745601,14811137,14876673,14942209,15073281,15138818,15204354,15269889,15400961,15532033,15597569,15794177,15859713,15925250,15990785,16121857,16187393,16252929,16318466,16384001,16449537,16515073,16580609,16646145,16711681,16842753,16908290,16973825,17039361,17104897,17170433,17235969,17301505,17367041,17432577,17563649,17694721,17825794,17891329,18022401,18087937,18153474,18219009,18284546,18350081,18481153,18546689,18612226,18677761,18743297,18808833,18874369,18939905,19005441,19136514,19267585,19333121,19464193,19529729,19595266,19660801,19726337,19791873,19922946,19988482,20054017,20119553,20185090,20250625,20316161,20381697,20447233,20512769,20643841,20709378,20774913,20905985,21037057,21102594,21168129,21233666,21364737,21430273,21495809,21561345,21692417,21823489,21889025,21954562,22020097,22085633,22216705,22282241,22347778,22413313,22478849,22544385,22609921,22675458,22740993,22806529,22872065,22937601,23003137],"contains":[720898,917505,983041,1114113,1310721,1376258,1835010,1966081,2031617,2097154,2424833,2686977,2818049,3014658,3080193,3670017,3735554,3801089,4259842,4390913,4456449,4521985,4587522,4784129,4915201,4980737,5373955,5439489,5505025,5636097,5701633,5767171,6029314,6094851,6160386,6291458,6356994,6422529,6619137,6881282,6946817,7274497,7536641,7602178,8126467,8257538,8323081,8388610,8912897,9043969,9240580,9764865,9830401,9961473,10092546,10223617,10354689,10682370,10813442,11010050,11075586,11272193,11337730,11468802,11599873,11730945,11993090,12058627,12255234,12320769,12582914,12910593,12976131,13041665,13107201,13172737,13238273,13303810,13631490,13697026,13762562,13893633,13959170,14090242,14155778,14221313,14286850,14483457,15138817,15204355,15269891,15335425,15859713,15925250,16187393,16318465,16449537,16515073,16580609,16646145,16777217,16842753,16973825,17170433,17301506,17367041,17432578,17498113,17694721,17825794,17891329,18087937,18153474,18219009,18350083,18415617,18546691,18612225,18743298,18874370,18939906,19005441,19136513,19660803,19988481,20054018,20381698,20709377,20774913,20840452,20905986,21364737,21823489,21889026,21954562,22085633,22282242,22347777,22413314,22609921,22675457,22872067,23003145],"corresponding":[1835009,13631489,15925249,21954561],"createclass":[11141121,12779521,20185089],"currentpage":[4063234,8323073,10485761,14614529,16908289,20971521,21168129,23003137,23068673],"completed":[720897,1376257,2097153,2818049,4259841,4521985,4587521,5439489,5701633,5767169,6029313,6160385,6291457,7536641,7602177,8257537,8388609,10813441,11010049,11075585,11337729,11993089,12058625,12255233,12976129,13959169,14155777,14286849,15269889,16580609,17301505,17432577,18350081,18546689,18743297,18939905,20054017,20381697,20905985,21889025,22282241,22413313],"customtypeproviders":[196610,524290,655361,2555906,3211265,3866625,3932162,5308417,6750209,7733250,9699330,10027009,10420225,10551297,12189700,12517378,12648450,14942210,15532034,17563650,18481154,20447235,21102596,22740994,22937602],"correct":[5963777,7340033,11796481],"createtype":[11141122,12779522,20185092],"contact":[19857409],"current":[393222,524289,655366,2752516,3145732,3211266,3342340,3866626,4063234,4718596,5308418,6750210,7012355,7340036,7471107,8585220,9306115,10420232,10485765,10551298,11141122,11206660,12189706,12517377,12713988,12779522,13500418,14614529,14942209,15532033,16121860,16908293,17039364,17760259,18284548,18481153,19595268,20185090,20447234,20971521,21102598,22740993,22937602],"column":[1769473,17629185,19660801,21757953,22872065,23003137],"cause":[393217,17760257],"createparameterctor":[458754,983042,4915202,5636098,8192003,13238274,16187394,19726339,20185090,21037059],"count":[262145,3276802,6422532,7012353,8323076,8650754,9043971,10485762,10682374,12124162,13303814,14614530,15728645,16908290,18219010,19005442,20971522,23003140],"collectionselector":[1835011,13631491,15925251,21954563]}
\ No newline at end of file
diff --git a/docs/fti/FTI_Files.json b/docs/fti/FTI_Files.json
deleted file mode 100644
index 10ebc61e0..000000000
--- a/docs/fti/FTI_Files.json
+++ /dev/null
@@ -1 +0,0 @@
-["System.Linq.Dynamic.Core, EntityFramework.DynamicLinq and Microsoft.EntityFrameworkCore.DynamicLinq - Redirect\u0000index.html\u000018","System.Linq.Dynamic.Core, EntityFramework.DynamicLinq and Microsoft.EntityFrameworkCore.DynamicLinq - Search\u0000search.html\u000020","DynamicQueryableExtensions.Last Method\u0000html/024bfd5b-b503-081f-f322-bba29b0db820.htm\u0000104","AbstractDynamicLinqCustomTypeProvider Constructor\u0000html/02b9674f-9507-89ed-6075-ac4bb10306cb.htm\u000069","GroupResult Properties\u0000html/034ae87e-3b08-4832-3d16-21f20a6e540f.htm\u000071","DynamicQueryableExtensions.TakeWhile Method\u0000html/059ea426-8283-f2ce-2fe8-a888fb9dfcc6.htm\u000077","ParseException Class\u0000html/00382765-2e26-f538-4a2d-b2485efd1a8e.htm\u0000437","ExpressionParser.Parse Method\u0000html/0147cbd2-56f7-960b-ff12-eeebdd444632.htm\u0000121","AbstractDynamicLinqCustomTypeProvider.ResolveTypeBySimpleName Method\u0000html/06f2e254-4629-ab9e-f08a-f7ada79ad522.htm\u0000130","DynamicQueryableExtensions.OrderBy(TSource) Method (Void, TSource, IQueryable, Void)\u0000html/0173022b-87b8-41c9-4857-667145b06553.htm\u0000431","AbstractDynamicLinqCustomTypeProvider Methods\u0000html/096e6ff0-87d8-1e79-18f5-203f368fc5e8.htm\u0000206","EntityFrameworkDynamicQueryableExtensions.FirstOrDefaultAsync Method (IQueryable, String, Object[])\u0000html/040bf9ea-b9bb-5e93-5ebf-69bd1920b899.htm\u0000319","ExpressionParser Constructor\u0000html/0949ca7b-63c6-318d-93de-6d1daeb05ac6.htm\u0000130","DynamicQueryableExtensions.Where Method\u0000html/09c64b73-29db-e275-a4af-2731ed091dc5.htm\u0000108","DynamicQueryableExtensions.GroupBy Method (IQueryable, ParsingConfig, String, String, Object[])\u0000html/08613265-5a58-a33f-3f89-f07332409549.htm\u0000346","DynamicExpressionParser.ParseLambda Method (Boolean, ParameterExpression[], Type, String, Object[])\u0000html/07acb50b-7caf-5314-ac76-1208f447580a.htm\u0000210","PagedResult(TSource).Queryable Property\u0000html/07e31581-5ef6-08c7-0908-ced5c957e39f.htm\u000085","DynamicEnumerableAsyncExtensions.ToDynamicArrayAsync Method (IEnumerable, Type)\u0000html/0468cae0-2fa0-3b7f-e933-61344ae24785.htm\u0000202","DynamicQueryableExtensions.Aggregate Method\u0000html/0cc7935a-094f-b630-5475-1805945d5ae6.htm\u0000213","DefaultQueryableAnalyzer Constructor\u0000html/0d0f8f36-4caf-0843-b34b-2bf738526b51.htm\u000067","DynamicQueryableExtensions.OfType Method (IQueryable, String)\u0000html/0aaa4b1b-f43a-d77c-3162-4702efe6d1e0.htm\u0000201","EntityFrameworkDynamicQueryableExtensions.SingleOrDefaultAsync Method (IQueryable, CancellationToken, String, Object[])\u0000html/0895ca9a-b605-7a25-c782-11e855864eb5.htm\u0000347","DynamicQueryableExtensions.Select Method\u0000html/09b1326f-d20c-fb04-9f6b-df23ec45a175.htm\u0000161","ParsingConfig.DisableMemberAccessToIndexAccessorFallback Property\u0000html/0b9fe7fa-93b0-c57f-9921-9f61263dcd9f.htm\u0000133","EntityFrameworkDynamicQueryableExtensions.LastAsync Method\u0000html/0bc0206d-0724-3891-b8d5-51c48abff2eb.htm\u0000143","DynamicClass.TryGetMember Method\u0000html/10a8e179-b946-1e70-1e92-c6ddb3f435ac.htm\u0000267","ParsingConfig Constructor\u0000html/10f9134f-6a1a-1160-0d58-e896f1aca0e7.htm\u000067","EntityFramework.DynamicLinq Namespace\u0000html/144078bd-d1ad-bece-4daa-7fdd3a7ed7dc.htm\u000086","DynamicQueryableExtensions.SelectMany Method (IQueryable, String, String, Object[], Object[])\u0000html/0b04dca9-60bd-34ab-b18e-03a98bde0479.htm\u0000375","EntityFrameworkDynamicQueryableExtensions.SingleOrDefaultAsync Method\u0000html/0c8043a5-5a1f-ed54-2d3b-8ad523c727af.htm\u0000164","DynamicQueryableExtensions.LastOrDefault Method (IQueryable)\u0000html/19090cca-6242-f6f4-36b6-0be4edb8ca90.htm\u0000189","DynamicQueryableExtensions.GroupJoin Method (IQueryable, ParsingConfig, IEnumerable, String, String, String, Object[])\u0000html/11a00ba7-3797-4af7-d1d1-9cc12dd6f4ac.htm\u0000363","EntityFrameworkDynamicQueryableExtensions.FirstOrDefaultAsync Method (IQueryable, String, Object[])\u0000html/132d20e8-30d9-a0a4-5124-5d1c13156303.htm\u0000323","DynamicQueryableExtensions.ThenBy Method\u0000html/1b52f8e5-8c07-3f7e-4cd0-00ab1b21b3df.htm\u0000109","System.Linq Namespace\u0000html/1c6270c8-551c-bdc4-37e6-023e785edea4.htm\u000045","DynamicProperty Properties\u0000html/19b5d1da-767b-33fa-2450-d623c55c4fc0.htm\u000053","DynamicQueryableExtensions.SingleOrDefault Method\u0000html/1e04daa1-5f80-6b39-c037-265c793bd6b8.htm\u0000202","DynamicQueryableExtensions.FirstOrDefault Method (IQueryable, String, Object[])\u0000html/1315ecfa-daa5-7b32-fe1f-2c457937d762.htm\u0000273","DynamicQueryableExtensions.OrderBy Method\u0000html/1480a26f-ba4e-6757-f81e-a750cb6e84be.htm\u0000105","AbstractDynamicLinqCustomTypeProvider.FindTypesMarkedWithDynamicLinqTypeAttribute Method\u0000html/180d2eba-43fc-bcd7-3179-f2e9dcbd6599.htm\u0000106","GroupResult.Items Property\u0000html/1cb33c56-fbd0-7439-26e9-f955171a8aa2.htm\u000077","DynamicExpressionParser.ParseLambda Method (ParsingConfig, ParameterExpression[], Type, String, Object[])\u0000html/19561d4b-7597-2bb0-d9ff-53b19c2a7b7d.htm\u0000216","ParsingConfig Methods\u0000html/2213dd4d-59f9-f837-5ab7-7866fd7fcf1e.htm\u0000152","EntityFrameworkDynamicQueryableExtensions.FirstAsync Method (IQueryable, CancellationToken)\u0000html/2230c785-24db-d017-a958-3d0fdd49ea71.htm\u0000245","DynamicQueryableExtensions.PageResult(TSource) Method (IQueryable, Void, TSource)\u0000html/133151c1-b3db-6f53-23fd-bca6b2c44d3e.htm\u0000375","IAssemblyHelper Methods\u0000html/1cf4ec89-2692-7736-8791-f42cacc3c7d7.htm\u000054","DynamicQueryableExtensions.LastOrDefault Method (IQueryable, ParsingConfig, String, Object[])\u0000html/1ea5b856-4a45-621d-07fb-8be44d84b059.htm\u0000273","DynamicQueryableExtensions.OrderBy Method (IQueryable, String, Object[])\u0000html/21a732e6-735e-5b2d-765b-ba7931521dbe.htm\u0000291","PagedResult Methods\u0000html/21b9dc8f-41ac-997f-6fc3-64351b5b1e67.htm\u0000152","System.Linq.Dynamic.Core.CustomTypeProviders Namespace\u0000html/2adefda4-0a38-b90a-4c33-ec6bcab66e8d.htm\u0000155","PagedResult.PageCount Property\u0000html/2c9e76dc-968c-3560-149f-328975b10c91.htm\u000084","DefaultQueryableAnalyzer Class\u0000html/2258d87b-2032-1d74-8e8a-b25377298a03.htm\u0000228","EntityFrameworkDynamicQueryableExtensions.CountAsync Method\u0000html/229e1980-ce7c-a4b5-01e0-d73c4a4183ec.htm\u000090","ExtensibilityPoint Fields\u0000html/2ee602f5-69fd-21ac-a1ad-e010a4708da4.htm\u000068","DynamicProperty Constructor\u0000html/2f28da13-3fcd-926c-2fa5-034bbc5cf86d.htm\u000098","PagedResult.Queryable Property\u0000html/243f0e8e-9609-2e8d-b088-2f3679df469f.htm\u000082","EntityFrameworkDynamicQueryableExtensions.FirstOrDefaultAsync Method\u0000html/29287a92-5040-ef0a-3012-74071dbb18f6.htm\u0000121","DynamicQueryableExtensions.Cast Method (IQueryable, ParsingConfig, String)\u0000html/260726ba-bf01-9db4-357a-5910d424756e.htm\u0000223","DynamicQueryableExtensions.Select Method (IQueryable, String, Object[])\u0000html/234ce2a1-921c-bae8-19b0-7968f3c6c87e.htm\u0000281","DynamicLinqTypeAttribute Methods\u0000html/23c1d3a3-0db1-9fb1-fe3d-1204e502f9ee.htm\u0000169","DefaultDynamicLinqCustomTypeProvider Constructor\u0000html/309b3000-751d-31ec-f12d-31ceade60ecf.htm\u0000106","DynamicQueryableExtensions.FirstOrDefault Method (IQueryable, LambdaExpression)\u0000html/2f911e16-18a7-ecff-6389-eb8194b44bd2.htm\u0000228","PagedResult.CurrentPage Property\u0000html/254eb037-08b8-6908-73ec-06a9535b513e.htm\u000084","DynamicClass Properties\u0000html/2664d667-ed19-c646-54ed-c9db2d9ad553.htm\u000048","ParsingConfig.AllowNewToEvaluateAnyType Property\u0000html/31718d6a-79f0-044f-6dbf-ede23f2061af.htm\u000090","EntityFrameworkDynamicQueryableExtensions.LastOrDefaultAsync Method (IQueryable, String, Object[])\u0000html/2ccf5092-bded-c090-5e55-625fa7908d1f.htm\u0000337","DynamicProperty.Type Property\u0000html/2d25accc-7354-7edc-1a2b-86ddd65740ce.htm\u000083","DynamicQueryableExtensions.Single Method (IQueryable, String, Object[])\u0000html/2fa0d1d9-0b97-9906-71ef-4cb3b3ed94ee.htm\u0000259","EntityFrameworkDynamicQueryableExtensions.AnyAsync Method\u0000html/369e6aa6-f96f-f4dd-06f2-7560309f8ca1.htm\u000085","EntityFrameworkDynamicQueryableExtensions.LastAsync Method (IQueryable, CancellationToken)\u0000html/26b0b5a3-247b-0209-4b7a-7ff8fb4c0c98.htm\u0000267","EntityFrameworkDynamicQueryableExtensions.FirstOrDefaultAsync Method (IQueryable, CancellationToken, String, Object[])\u0000html/2ad5ed20-e833-50e0-d4fb-8e1d0a44229c.htm\u0000347","DynamicQueryableExtensions.Where(TSource) Method (Void, TSource, IQueryable, Void)\u0000html/3341bd53-2b91-10a4-7f2a-2af379592611.htm\u0000431","ExpressionParser Methods\u0000html/338e1130-f4c3-67b5-3977-34f5c2813f12.htm\u0000167","DynamicQueryableExtensions.Join Method (IQueryable, IEnumerable, String, String, String, Object[])\u0000html/2e4513d7-4001-9937-6ff2-c88404490299.htm\u0000327","DynamicClass.Item Property\u0000html/2ee00d35-a249-077d-04f7-6e8d035dcfb2.htm\u0000112","DynamicExpressionParser.ParseLambda Method (ParsingConfig, Boolean, ParameterExpression[], Type, String, Object[])\u0000html/37641f28-2b4c-1a90-e253-15e87d91dd47.htm\u0000230","DynamicQueryableExtensions.SelectMany Method (IQueryable, ParsingConfig, Type, String, Object[])\u0000html/276b19f7-dfb2-f52d-df4a-7e367f12b235.htm\u0000314","System.Linq.Dynamic.Core.Exceptions Namespace\u0000html/3f310d0d-47d1-c5af-63bf-2bb2cd48f9dc.htm\u000039","DynamicClass Methods\u0000html/3c0f5b0c-c3a6-cf67-bf11-b7997ecc1d2b.htm\u0000170","DynamicQueryableExtensions.GroupByMany(TElement) Method (IEnumerable(TElement), ParsingConfig, String[])\u0000html/33b0c784-9ef9-7af8-a4e4-195794ecddd1.htm\u0000271","DynamicQueryableExtensions.SelectMany(TResult) Method (Void, TResult, IQueryable, ParsingConfig)\u0000html/3a401275-29f1-664f-0c26-e5fe4d4aa322.htm\u0000447","DefaultDynamicLinqCustomTypeProvider.ResolveTypeBySimpleName Method\u0000html/3f97a6b3-b805-4e5b-d0f0-a10e48ece1ae.htm\u000081","EntityFrameworkDynamicQueryableExtensions Methods\u0000html/38c4b637-b07c-3339-19a3-c93c778f64f3.htm\u0000689","EntityFrameworkDynamicQueryableExtensions.SingleOrDefaultAsync Method (IQueryable, CancellationToken)\u0000html/3452b730-de6d-986a-914f-14a0eab97dd8.htm\u0000284","ParseException.GetObjectData Method\u0000html/3508fc53-16f9-f409-6784-2572b063b281.htm\u0000141","DynamicClass.GetDynamicPropertyValue Method\u0000html/3ccebd50-94d3-b01b-5152-602a96eba478.htm\u000054","DynamicExpressionParser.ParseLambda Method (Boolean, Type, Type, String, Object[])\u0000html/3acf73c0-5300-6f59-97f6-f0c35e6db695.htm\u0000208","EntityFrameworkDynamicQueryableExtensions.LastAsync Method (IQueryable, CancellationToken)\u0000html/3ad2010d-6efd-39f7-e6bc-30955cb4fbf6.htm\u0000263","EntityFrameworkDynamicQueryableExtensions.CountAsync Method (IQueryable, String, Object[])\u0000html/37f8ecfe-fab1-579a-8d06-1b76d7e2c537.htm\u0000293","DynamicClass Constructor\u0000html/3944ac97-d70b-410f-89de-bbf48afaf980.htm\u000067","DynamicQueryableExtensions.GroupJoin Method\u0000html/4604db99-bf8f-7e67-5c9b-d23c5b8cd3f8.htm\u0000113","ParsingConfig Properties\u0000html/4771be47-ef15-eabc-87a7-18df1bc57ee1.htm\u0000425","EntityFrameworkDynamicQueryableExtensions.CountAsync Method (IQueryable, CancellationToken)\u0000html/3bfc4ced-5b36-d1a4-32f6-1d8fe54500b9.htm\u0000249","DynamicQueryableExtensions.Any Method (IQueryable, ParsingConfig, String, Object[])\u0000html/356f7e9e-a480-6e2d-df6c-ee2fab1fd24b.htm\u0000322","EntityFrameworkDynamicQueryableExtensions.FirstOrDefaultAsync Method (IQueryable, CancellationToken, String, Object[])\u0000html/3daf092d-539c-7658-44fd-048a1fb76378.htm\u0000343","ExtensibilityPoint Constructor\u0000html/48ee95cc-367e-f2ee-6a10-d1d51f1d7c38.htm\u000067","EntityFrameworkDynamicQueryableExtensions.LastOrDefaultAsync Method (IQueryable, CancellationToken, String, Object[])\u0000html/38b4c8b7-3d22-8847-e49d-f72c8612b2e5.htm\u0000365","DynamicQueryableExtensions.SkipWhile Method (IQueryable, String, Object[])\u0000html/4786ab5f-40fe-a19d-8d7f-a7d718a59284.htm\u0000313","DynamicQueryableExtensions.Count Method (IQueryable)\u0000html/3ee48aa3-346b-30a0-6fbc-617192647c7e.htm\u0000197","DynamicClass.SetDynamicPropertyValue(T) Method (String, T)\u0000html/4b53e119-96c1-e2b9-34be-98c7caf0c437.htm\u0000111","ExpressionParser Properties\u0000html/4d9b469b-c6a0-f277-b9ad-0d1d28917d8e.htm\u000061","DynamicQueryableExtensions.Page Method (IQueryable, Int32, Int32)\u0000html/4db734f7-42a3-3502-6396-a134ed1dc333.htm\u0000202","DynamicClass.SetDynamicPropertyValue Method\u0000html/4fc51792-2e11-7c78-6601-69b6194e7236.htm\u000059","IDynamicLinkCustomTypeProvider Methods\u0000html/4fcb74af-e8be-d74c-c3c0-9ea78251a06b.htm\u000085","DynamicQueryableExtensions.GroupByMany(TElement) Method (IEnumerable(TElement), String[])\u0000html/439b09bc-d6d7-1575-609a-520a5c650cd9.htm\u0000253","DynamicQueryableExtensions.Where Method (IQueryable, String, Object[])\u0000html/482af584-da29-573b-8137-93234d9d9550.htm\u0000339","DynamicQueryableExtensions.GroupJoin Method (IQueryable, IEnumerable, String, String, String, Object[])\u0000html/4e34232c-cc6d-42fb-a914-cb2b813387f1.htm\u0000345","GroupResult Class\u0000html/5322a78d-cbe3-7e65-f001-78f5dadfe009.htm\u0000265","EntityFrameworkDynamicQueryableExtensions.SingleOrDefaultAsync Method\u0000html/53d96749-3c43-cd07-6619-94fb85a7a641.htm\u0000163","ParsingConfig.Default Property\u0000html/5c3cbed3-465e-2b69-3210-344dd57bf7eb.htm\u000073","DynamicEnumerableExtensions Class\u0000html/58a7de95-1c6b-378b-31e1-88789cce70b0.htm\u0000134","DynamicEnumerableAsyncExtensions.ToDynamicArrayAsync(T) Method (IEnumerable)\u0000html/4e37830c-9940-e285-976a-164ac954c518.htm\u0000196","ParsingConfig Class\u0000html/538022bc-a0ba-e89d-99bc-b9a9a313d75d.htm\u0000604","ExtensibilityPoint.QueryOptimizer Field\u0000html/5399fd1f-0b55-99e4-de3f-cdb5694be302.htm\u0000106","GroupResult Methods\u0000html/53c2e70f-f99b-222f-951d-99d38056ec33.htm\u0000161","EntityFrameworkDynamicQueryableExtensions.SingleOrDefaultAsync Method (IQueryable, CancellationToken)\u0000html/5cab7506-9a7d-fff2-8dc1-6c37f2b960f8.htm\u0000280","EntityFrameworkDynamicQueryableExtensions.AnyAsync Method (IQueryable, String, CancellationToken, Object[])\u0000html/454e591d-cdeb-969c-afc1-4d26dfd8ae43.htm\u0000326","DynamicEnumerableExtensions.ToDynamicList Method (Void, Object)\u0000html/5d6f2e38-214a-4945-d160-ca40abda184b.htm\u0000256","DefaultDynamicLinqCustomTypeProvider.GetCustomTypes Method\u0000html/4f3b8d53-8bb0-f985-6d80-9f7dca8fbd73.htm\u000095","DynamicQueryableExtensions.Where(TSource) Method (Void, TSource, IQueryable)\u0000html/5b8a276a-f777-ebd8-bc2e-fdaae0d40591.htm\u0000372","EntityFrameworkDynamicQueryableExtensions.CountAsync Method\u0000html/657799f7-4fc6-c4f4-dd51-1381a708d6b1.htm\u000091","DynamicQueryableExtensions.Join Method\u0000html/58c07e13-ecda-5b51-166e-30c41e312af7.htm\u0000143","DynamicClass.TrySetMember Method\u0000html/5e17e33c-4089-d86f-eb0f-c16155d2845f.htm\u0000282","DynamicQueryableExtensions.GroupByMany Method\u0000html/55a6c83e-c581-8ac9-f803-434224d5fbc6.htm\u0000152","EntityFrameworkDynamicQueryableExtensions Methods\u0000html/5df0a6ee-f8a7-59ba-5ca8-0972aade618b.htm\u0000688","DynamicExpressionParser.ParseLambda(TResult) Method (Void, Func(TResult), ParsingConfig, Boolean, ParameterExpression[])\u0000html/5f830eca-c091-f095-c8c9-761e3ade1352.htm\u0000506","EntityFrameworkDynamicQueryableExtensions.AnyAsync Method (IQueryable, String, Object[])\u0000html/644b1d01-9ef6-e0e9-e9ac-db78fc523bd3.htm\u0000296","DynamicQueryableExtensions Methods\u0000html/0e9009a8-cfed-c48e-51ad-e8d7d2dbd8d3.htm\u00002481","EntityFrameworkDynamicQueryableExtensions.LastAsync Method (IQueryable, CancellationToken, String, Object[])\u0000html/5e52270c-d1f9-9085-34eb-82051fff7285.htm\u0000331","DynamicQueryableExtensions.Cast Method\u0000html/6b9e99a7-18b8-480f-a84e-bdef5ff5e8dd.htm\u000081","DynamicProperty.Name Property\u0000html/70888c8c-cd18-0b35-48c1-2b02ec97be69.htm\u000083","DynamicProperty Methods\u0000html/6ce00864-df23-80ac-8d41-76c6c94319ed.htm\u0000152","PagedResult.RowCount Property\u0000html/68df6dc2-9655-b3b2-efce-3d3ca2265965.htm\u000084","GroupResult Constructor\u0000html/724e1f4a-6a2a-ec95-6829-67afcc95acbd.htm\u000067","DynamicQueryableExtensions.First Method\u0000html/60cf4e3d-b957-8668-65f6-d6c4150f6480.htm\u0000104","DynamicExpressionParser.ParseLambda Method\u0000html/502b87ce-612e-3be3-2f65-ba7e3e6b1b18.htm\u0000417","DynamicQueryableExtensions.SelectMany Method (IQueryable, Type, String, Object[])\u0000html/69228784-5dff-d9e3-bcdf-3064d1e7e027.htm\u0000296","IQueryableAnalyzer Interface\u0000html/10746d82-d300-0ddf-3818-6c4f3e69a2d2.htm\u000084","DynamicQueryableExtensions.Count Method (IQueryable, LambdaExpression)\u0000html/685b13e4-b7fc-3911-5146-f804d01dbe30.htm\u0000197","ExpressionParser.ItName Property\u0000html/6e0a75d1-4793-5db1-466d-e0917e7da1be.htm\u000094","DynamicQueryableExtensions.SelectMany(TResult) Method (Void, TResult, IQueryable)\u0000html/70851e62-d7c1-8d85-5dea-6cb130c11452.htm\u0000365","DynamicQueryableExtensions.Any Method\u0000html/7199abad-ffd3-d84e-a9b5-87e29c1da288.htm\u000089","ParseException Properties\u0000html/4f801c37-c1cf-e3cf-a94f-339d3778e54f.htm\u0000220","ParsingConfig.ResolveTypesBySimpleName Property\u0000html/6e6f50a9-368d-0559-c8ec-48139bbdbcbc.htm\u0000141","PagedResult Constructor\u0000html/6edcd149-bf11-b2c0-7675-623978830762.htm\u000067","DynamicQueryableExtensions.Last Method (IQueryable, LambdaExpression)\u0000html/675c4168-01f8-7297-65b8-5a87a252eeec.htm\u0000199","DynamicQueryableExtensions.SingleOrDefault Method (IQueryable, LambdaExpression)\u0000html/77c2c620-2401-5409-c20d-f13cc70b8677.htm\u0000223","IExpressionPromoter.Promote Method\u0000html/737e51e1-0b7e-9d1b-fc5f-5bf46603b9f7.htm\u0000126","AbstractDynamicLinqCustomTypeProvider.GetAssemblyTypesWithDynamicLinqTypeAttribute Method\u0000html/6e6dc88f-a0fa-eb1e-69f2-e5a3dcbcd684.htm\u0000111","EntityFrameworkDynamicQueryableExtensions.FirstOrDefaultAsync Method\u0000html/60f75a32-d2a6-3473-c73a-ce56c1b18051.htm\u0000120","DynamicQueryableExtensions.Distinct Method\u0000html/72cfe082-7b9b-1c6d-f8ec-c377fb91714d.htm\u0000215","DynamicQueryableExtensions.AsEnumerable Method\u0000html/7c2ec062-e0e3-b552-4277-9b0711399d1e.htm\u0000177","DynamicQueryableExtensions.LastOrDefault Method (IQueryable, LambdaExpression)\u0000html/7cfc606a-d9ef-cafb-e857-9007d67df7b2.htm\u0000210","DynamicLinqTypeAttribute Properties\u0000html/74693236-4b0a-c69f-f329-0f841107255e.htm\u000062","DynamicQueryableExtensions.SkipWhile Method (IQueryable, ParsingConfig, String, Object[])\u0000html/722f1465-6015-427b-8559-2eb3048e19ae.htm\u0000331","DynamicEnumerableAsyncExtensions.ToDynamicArrayAsync Method\u0000html/7f35c3c4-5195-a494-b036-04afaa2225a6.htm\u000080","DynamicQueryableExtensions.SelectMany Method (IQueryable, ParsingConfig, String, Object[])\u0000html/75d0dd76-16d2-c498-6ffb-77a079ae7c96.htm\u0000291","ParsingConfig.CustomTypeProvider Property\u0000html/76eaefbe-f902-28bd-e26e-e43142ca1493.htm\u000080","DynamicQueryableExtensions.GroupBy Method (IQueryable, String, String, Object[])\u0000html/57882284-95fe-0180-a958-63450b1814ac.htm\u0000328","DefaultDynamicLinqCustomTypeProvider Methods\u0000html/7aecbfa8-8b16-a50a-29fe-7214fbc5aa63.htm\u0000297","PagedResult(TSource) Class\u0000html/5aba9200-bd4e-f860-8d36-0afe892d923e.htm\u0000305","DefaultDynamicLinqCustomTypeProvider.ResolveType Method\u0000html/67829a69-deb4-f55a-359f-7d7d4e816d15.htm\u000075","DynamicQueryableExtensions.DefaultIfEmpty Method\u0000html/737f1217-f4a7-2b71-0afe-51f2c079f4ad.htm\u000085","DynamicQueryableExtensions.Count Method (IQueryable, String, Object[])\u0000html/7da3a81b-d09d-dd8f-4084-8a4e9abf6b8d.htm\u0000307","ParseException Constructor\u0000html/864bd614-3384-4c20-33df-896092842fd8.htm\u0000112","EntityFrameworkDynamicQueryableExtensions.LastAsync Method (IQueryable, String, Object[])\u0000html/7ee1ea23-6e49-9cb0-b08f-9b637860f771.htm\u0000307","DynamicQueryableExtensions.SelectMany Method\u0000html/759a2119-4b7a-6819-4b57-103452d73ce7.htm\u0000383","DynamicQueryableExtensions.Sum Method\u0000html/81582e5f-6219-ef6d-b46f-dbe6a3d3cd75.htm\u0000172","EntityFrameworkDynamicQueryableExtensions.SingleOrDefaultAsync Method (IQueryable, String, Object[])\u0000html/502d0af8-44ef-d218-e918-dfd133663727.htm\u0000327","EntityFrameworkDynamicQueryableExtensions.LastOrDefaultAsync Method (IQueryable, CancellationToken, String, Object[])\u0000html/7b990b0a-fc6a-828c-6638-8cb36e05d3e8.htm\u0000361","DynamicClassFactory Methods\u0000html/844c188b-1abe-ae61-9fed-3bcfa67f1147.htm\u0000237","ExpressionParser Class\u0000html/8a0191e5-d3df-a99b-f4b2-a995106fd951.htm\u0000250","DynamicQueryableExtensions.SingleOrDefault Method (IQueryable, String, Object[])\u0000html/8aab3dd1-6d5d-0748-73c5-69370e324482.htm\u0000268","EntityFrameworkDynamicQueryableExtensions.LastAsync Method (IQueryable, String, Object[])\u0000html/7d61c2db-d394-9366-0403-a124d6b62d35.htm\u0000311","DynamicQueryableExtensions.Single Method\u0000html/5abed614-073a-f031-8a3b-e7a9bb4b424a.htm\u0000164","DynamicQueryableExtensions.Cast Method (IQueryable, Type)\u0000html/84c56248-70cb-4832-22b1-515d88eaffac.htm\u0000205","DynamicEnumerableExtensions.ToDynamicList Method\u0000html/8c6db65a-0c75-1a36-f23f-4d0e58deef00.htm\u000044","DynamicQueryableExtensions.GroupBy Method (IQueryable, String, Object[])\u0000html/82cab2b4-8a2a-f0b1-0b02-004e75f7e79f.htm\u0000291","DynamicEnumerableExtensions.ToDynamicList(T) Method (Void)\u0000html/89c8f7e0-cb19-fa0e-c577-6fe27d3cd67a.htm\u0000251","DynamicQueryableExtensions.ThenBy Method (IOrderedQueryable, ParsingConfig, String, Object[])\u0000html/61a8cd31-bcc5-a9dc-7d60-20cb67e58ae6.htm\u0000324","ParsingConfig.RenameParameterExpression Property\u0000html/8207c093-83e3-6d90-796f-1e9a0e6d629d.htm\u000096","DynamicQueryableExtensions.Join(TElement) Method (Void, TElement, IQueryable, Void, TElement, ParsingConfig, IEnumerable(TElement))\u0000html/858da6b8-f29c-5d90-5b25-e20a7a586c29.htm\u0000743","GroupResult.Subgroups Property\u0000html/901a4d67-1b67-6548-5c87-421c5a788bd6.htm\u000083","EntityFrameworkDynamicQueryableExtensions.LastOrDefaultAsync Method (IQueryable, CancellationToken)\u0000html/86eda2ff-d3ff-a82f-8a90-38aabe127953.htm\u0000282","EntityFrameworkDynamicQueryableExtensions.CountAsync Method (IQueryable, String, Object[])\u0000html/84f7fe3f-636b-0feb-ff49-aad91a4b7bb8.htm\u0000297","GroupResult.Count Property\u0000html/581b1f5b-6cd3-99b2-f883-4863377c3d48.htm\u000079","DefaultDynamicLinqCustomTypeProvider Class\u0000html/8c9e6389-18cd-6269-6181-8b148678cfa9.htm\u0000423","EntityFrameworkDynamicQueryableExtensions.LastOrDefaultAsync Method (IQueryable, CancellationToken)\u0000html/8d73972a-7c0f-675f-b7b5-d3ec03b3a65a.htm\u0000286","DynamicQueryableExtensions.Single Method (IQueryable, ParsingConfig, String, Object[])\u0000html/7c38607d-2d4d-72c0-8b05-cc87b1289b24.htm\u0000277","ParsingConfig.UseDynamicObjectClassForAnonymousTypes Property\u0000html/67e6b069-db4f-17b2-37c1-4040b8c1a7d3.htm\u000094","EntityFrameworkDynamicQueryableExtensions.FirstAsync Method\u0000html/8d5eb1b0-1ad8-5617-e4e0-519da559cf82.htm\u000090","AbstractDynamicLinqCustomTypeProvider.ResolveType Method\u0000html/98eecc70-2dfd-5365-3d57-1e49a10ba940.htm\u0000125","DynamicQueryableExtensions.Where Method (IQueryable, ParsingConfig, String, Object[])\u0000html/8b4a66b3-acb2-e86d-daa2-b07d8cbb4ea1.htm\u0000357","IDynamicLinkCustomTypeProvider.GetCustomTypes Method\u0000html/625b349f-10ed-e15a-a339-63656c4d6ed0.htm\u000090","PagedResult(TSource) Methods\u0000html/82c756ac-ae74-3b28-29eb-9603454229c7.htm\u0000156","DynamicClassFactory Class\u0000html/8ae68a72-152c-5428-1973-60844a869bae.htm\u0000303","ParseException.Position Property\u0000html/94081853-6911-cf5a-3e02-6c4ef8c8e633.htm\u000084","DynamicExpressionParser.ParseLambda Method (Type, Type, String, Object[])\u0000html/8f200c54-1c0d-42a2-7926-ab1bcb8732b0.htm\u0000194","EntityFrameworkDynamicQueryableExtensions.AnyAsync Method (IQueryable, CancellationToken)\u0000html/97298d8a-a2a0-2a1a-b264-9c3c6d1bee00.htm\u0000255","DynamicQueryableExtensions.OrderBy Method (IQueryable, ParsingConfig, String, Object[])\u0000html/9427752d-ed04-93d2-b843-12c4601bf12c.htm\u0000309","DynamicQueryableExtensions.Last Method (IQueryable, String, Object[])\u0000html/50bfc0d4-4b1e-8b73-12c9-30a2b76340e0.htm\u0000244","DynamicEnumerableAsyncExtensions.ToDynamicArrayAsync Method (IEnumerable)\u0000html/8dd2dd01-f5ac-818b-e76b-1c2209e63823.htm\u0000186","DynamicExpressionParser.ParseLambda Method (ParsingConfig, Boolean, Type, String, Object[])\u0000html/8ed3caeb-f17e-a788-72d5-4ee37624e7d5.htm\u0000208","DynamicQueryableExtensions.Count Method (IQueryable, ParsingConfig, String, Object[])\u0000html/97fb97e3-3214-2b41-46d1-12db4af02137.htm\u0000325","DynamicQueryableExtensions.Select(TResult) Method (Void, TResult, IQueryable)\u0000html/9f491ab7-fef4-6562-7d05-68649113953a.htm\u0000365","DynamicQueryableExtensions.SkipWhile Method\u0000html/9252fe17-2fa4-d444-db5a-4a2a3adaa51f.htm\u000089","ParseException.ToString Method\u0000html/62888e13-2fc9-e3df-0d7e-23455c12f578.htm\u000091","DynamicExpressionParser Class\u0000html/897c5927-6102-febf-7b76-c0e9a179886f.htm\u0000464","DynamicQueryableExtensions.SelectMany Method (IQueryable, String, String, String, String, Object[], Object[])\u0000html/9e3aa1e6-1f42-4ee4-2f95-465f90028816.htm\u0000419","DynamicQueryableExtensions.Any Method (IQueryable, LambdaExpression)\u0000html/bf5be831-4e5d-7898-e7fb-18dafc1d519b.htm\u0000194","DynamicQueryableExtensions.LastOrDefault Method (IQueryable, String, Object[])\u0000html/8ca28150-10d6-2780-268c-d180f0cb7b7e.htm\u0000255","DynamicFunctions Class\u0000html/94c5611e-fa6f-58a7-b446-c95aa4b99e92.htm\u000078","DynamicQueryableExtensions.FirstOrDefault Method (IQueryable, ParsingConfig, String, Object[])\u0000html/9bafb854-4a07-e4fe-0945-b4c2c40e3d9e.htm\u0000291","EntityFrameworkDynamicQueryableExtensions.SingleOrDefaultAsync Method (IQueryable, CancellationToken, String, Object[])\u0000html/99445602-946e-1678-2afd-18cc8e70eec6.htm\u0000351","ParsingConfig.DefaultEFCore21 Property\u0000html/c2d6f5cb-9277-d7c3-4e32-abfdd20b6300.htm\u000080","DynamicQueryableExtensions.TakeWhile Method (IQueryable, String, Object[])\u0000html/b31fb887-ec5e-90c5-2043-f9e8008f4089.htm\u0000305","EntityFrameworkDynamicQueryableExtensions.AnyAsync Method (IQueryable, String, CancellationToken, Object[])\u0000html/a98ac9bb-ddc6-b369-68f9-8ba2b6cc6f5b.htm\u0000330","DynamicQueryableExtensions.Last Method (IQueryable, ParsingConfig, String, Object[])\u0000html/9fad9d05-8e5d-bafc-fc03-47db3d1c7253.htm\u0000262","EntityFrameworkDynamicQueryableExtensions.SingleOrDefaultAsync Method (IQueryable, String, Object[])\u0000html/b5bb5377-cb98-da08-a5db-732905ff323e.htm\u0000323","IQueryableAnalyzer Methods\u0000html/c6055bf8-59c5-fbca-01b7-3f5c47414829.htm\u000050","DynamicQueryableExtensions.ThenBy(TSource) Method (Void, TSource, IOrderedQueryable, Void)\u0000html/8c56b84d-b783-244e-c083-8845b4b523cb.htm\u0000431","DynamicQueryableExtensions.Where Method (IQueryable, LambdaExpression)\u0000html/b63dbea1-f9be-1fa1-df74-ecdd281c06c7.htm\u0000197","IExpressionPromoter Interface\u0000html/c163ce6b-21e1-df62-207f-49053fd04c27.htm\u0000100","PagedResult Properties\u0000html/97aa85dd-7d55-7d4a-d16c-6151057d4e14.htm\u000078","DynamicQueryableExtensions.OfType Method\u0000html/50e96fe4-c3ee-d8ac-06eb-d57b9728b4ea.htm\u000084","DynamicQueryableExtensions.Select(TResult) Method (Void, TResult, IQueryable, ParsingConfig)\u0000html/8f373d34-e216-398e-a63e-296165a40c5a.htm\u0000447","ParsingConfig.UseParameterizedNamesInDynamicQuery Property\u0000html/9ef43177-e01a-9e3d-37e6-258a482c680a.htm\u0000108","DynamicQueryableExtensions.OrderBy(TSource) Method (Void, TSource, IQueryable)\u0000html/c49a2fb5-2fd6-896d-d9b9-6872b1bc7116.htm\u0000372","IDynamicLinkCustomTypeProvider.ResolveType Method\u0000html/634f3950-239e-2e25-9554-cc4f2f5c74ef.htm\u0000104","EntityFrameworkDynamicQueryableExtensions.LastAsync Method\u0000html/c2dce7cc-70cd-a723-4b0c-60aa5478cade.htm\u0000144","DynamicQueryableExtensions.First Method (IQueryable)\u0000html/b4db88ae-5d05-c16e-3934-a647e67baa4d.htm\u0000170","DynamicQueryableExtensions.GroupBy Method (IQueryable, ParsingConfig, String, Object[])\u0000html/c32c300b-e2da-0f93-2861-7786dfb3bfdf.htm\u0000309","DynamicQueryableExtensions.Any Method (IQueryable, String, Object[])\u0000html/c99307f1-492e-26c3-68e7-2ffa71ee4598.htm\u0000304","EntityFrameworkDynamicQueryableExtensions.AnyAsync Method (IQueryable, CancellationToken)\u0000html/c023cc71-ddee-1216-72bf-325a937c84f5.htm\u0000251","DynamicQueryableExtensions.FirstOrDefault Method\u0000html/ca3a380a-0fe3-cea2-0107-f7ca1d5bd9fe.htm\u0000145","GroupResult.ToString Method\u0000html/94cfad6d-e734-f70f-3352-98a53c8d947e.htm\u000092","DynamicEnumerableAsyncExtensions Methods\u0000html/c1be0fc8-f6e4-6bfe-4da7-329414bf8359.htm\u000091","IDynamicLinkCustomTypeProvider.ResolveTypeBySimpleName Method\u0000html/9d0014ca-516c-287a-f70c-988ee9668b30.htm\u0000106","DynamicQueryableExtensions.Join(TElement) Method (Void, TElement, IQueryable, Void, TElement, IEnumerable(TElement))\u0000html/98ec7b39-c188-0dfc-6913-d8833d4a841e.htm\u0000632","DynamicEnumerableExtensions.ToDynamicArray Method\u0000html/cde853fb-e83a-0911-6f76-7f04e385b62c.htm\u000077","DynamicQueryableExtensions.Count Method\u0000html/c49f9809-5da8-58fb-8339-86c7093be0a8.htm\u000093","DynamicQueryableExtensions.First Method (IQueryable, LambdaExpression)\u0000html/cf555f7f-d2b6-dd9e-7b18-74299672fc73.htm\u0000199","DynamicEnumerableExtensions.ToDynamicArray Method (IEnumerable, Type)\u0000html/c4843660-11b6-56d9-f85b-60bc13755db4.htm\u0000196","DynamicQueryableExtensions.SelectMany Method (IQueryable, ParsingConfig, String, String, Object[], Object[])\u0000html/9b48256e-3052-d01e-df06-deb7bae66d93.htm\u0000403","DefaultQueryableAnalyzer.SupportsLinqToObjects Method\u0000html/9fca694c-b3f8-dce0-ddfb-747f4de298a5.htm\u0000128","DynamicExpressionParser Methods\u0000html/7cc37a25-17e5-34f7-e023-83576a9f15ff.htm\u0000415","DefaultQueryableAnalyzer Methods\u0000html/ca4fe1f4-1f13-01d5-a6b7-3a0b3fdd0203.htm\u0000165","DynamicExpressionParser.ParseLambda Method (ParsingConfig, Boolean, Type, Type, String, Object[])\u0000html/b5d6ef5a-f11d-2f52-63d2-e7107c905aa6.htm\u0000228","DynamicClass.SetDynamicPropertyValue Method (String, Object)\u0000html/d6e97f9c-e7b8-dfff-6695-b293bac9f296.htm\u0000102","DynamicQueryableExtensions.SelectMany Method (IQueryable, String, Object[])\u0000html/c8295914-1540-2db7-c32e-64bc03dc0be6.htm\u0000273","DynamicEnumerableAsyncExtensions.ToDynamicListAsync Method (Void, Object)\u0000html/cae4f816-bb4a-f03a-a557-c7ad09b5a719.htm\u0000262","DynamicQueryableExtensions.First Method (IQueryable, ParsingConfig, String, Object[])\u0000html/a9aaca32-c004-9567-8470-009b725fb966.htm\u0000262","DynamicEnumerableExtensions.ToDynamicArray Method (IEnumerable)\u0000html/da78abc2-279f-beff-343e-6802a2d6d71d.htm\u0000180","EntityFrameworkDynamicQueryableExtensions.FirstAsync Method (IQueryable, CancellationToken)\u0000html/ce214401-dbe6-51b3-6eff-7123a7c778ad.htm\u0000249","DynamicQueryableExtensions.OfType Method (IQueryable, Type)\u0000html/b6438175-d119-7f45-11f3-c98fd564f01c.htm\u0000201","IAssemblyHelper.GetAssemblies Method\u0000html/50f9cc5e-8dc9-6fcf-23a6-0a2751295c12.htm\u000093","EntityFrameworkDynamicQueryableExtensions.LastOrDefaultAsync Method\u0000html/dde5b439-ba6c-42bd-a39d-e163271019dd.htm\u0000175","DynamicExpressionParser.ParseLambda Method (Type, String, Object[])\u0000html/cb9087d9-5f3b-378b-3640-6e3880c4ffa7.htm\u0000174","PagedResult Class\u0000html/d6a52ff1-1fd8-e1b3-b372-61d314a78d5e.htm\u0000256","DynamicQueryableExtensions.First Method (IQueryable, String, Object[])\u0000html/d0aca88b-6e17-8548-6c69-b1494762f3df.htm\u0000244","ExtensibilityPoint Methods\u0000html/7cc7d11d-e286-ba9c-e050-0b074fa6d9cf.htm\u0000152","DynamicQueryableExtensions.Single Method (IQueryable, LambdaExpression)\u0000html/d74490d2-17c1-ac5f-caa3-1e882d0a2746.htm\u0000214","DynamicClass.GetDynamicMemberNames Method\u0000html/d3f866e9-1b22-2c6d-0c5a-1cd29ab09730.htm\u000090","PagedResult.PageSize Property\u0000html/ce1cbbfd-3590-be85-de65-a92190be3d28.htm\u000088","EntityFrameworkDynamicQueryableExtensions.FirstAsync Method (IQueryable, CancellationToken, String, Object[])\u0000html/63aaaf13-715c-7333-d0e3-3dd00935aea8.htm\u0000313","DynamicEnumerableExtensions.ToDynamicArray(T) Method (IEnumerable)\u0000html/d0a8c071-ea89-3dc6-2510-1bde7cdff0f6.htm\u0000191","EntityFrameworkDynamicQueryableExtensions.FirstAsync Method (IQueryable, CancellationToken, String, Object[])\u0000html/d129e142-6c8c-79c7-468c-e3783d1d977f.htm\u0000317","EntityFrameworkDynamicQueryableExtensions.LastOrDefaultAsync Method\u0000html/cc0ffba1-1feb-5351-ec86-dd9d01bb025c.htm\u0000174","DynamicLinqTypeAttribute Constructor\u0000html/d6e24413-512d-f9d2-b470-e7b497242961.htm\u000069","System.Linq.Dynamic.Core Namespace\u0000html/de47654c-7ae4-9302-3061-ea6307706cb8.htm\u0000321","DynamicExpressionParser.ParseLambda Method (ParameterExpression[], Type, String, Object[])\u0000html/96be8c30-44a1-cf11-a1a9-2f162b69f904.htm\u0000197","ParseException Methods\u0000html/cb8166eb-490f-ac7a-3759-9bf25cd3c1e3.htm\u0000167","DynamicQueryableExtensions.Any Method (IQueryable)\u0000html/a9b9c3c4-e23e-87d4-d365-fb08cd5a94eb.htm\u0000198","DynamicQueryableExtensions.Join Method (IQueryable, ParsingConfig, IEnumerable, String, String, String, Object[])\u0000html/d870c15e-1241-5d9e-9eaa-01c04b808e69.htm\u0000345","DynamicQueryableExtensions.GroupBy Method\u0000html/a05fe883-3a66-89c9-9fce-6ea5c8d8d8d5.htm\u0000237","DynamicEnumerableAsyncExtensions.ToDynamicListAsync Method (Void)\u0000html/e7bacec7-9ab4-161b-78cb-cec2bb267c78.htm\u0000218","DynamicQueryableExtensions.SingleOrDefault Method (IQueryable, ParsingConfig, String, Object[])\u0000html/dfb940e9-b6d9-1ad9-d321-1037ba6f5647.htm\u0000286","DynamicQueryableExtensions.TakeWhile Method (IQueryable, ParsingConfig, String, Object[])\u0000html/e0821bd0-c03e-990b-0ef1-c2637f587df7.htm\u0000323","DynamicQueryableExtensions.Skip Method\u0000html/eab3892f-592a-49d0-88fa-f3d85dbd1552.htm\u0000202","ExtensibilityPoint Class\u0000html/e8054e46-4edd-0108-00f6-0af9ce5918b9.htm\u0000260","EntityFrameworkDynamicQueryableExtensions.CountAsync Method (IQueryable, CancellationToken, String, Object[])\u0000html/dd2d36b4-81cd-71fe-876e-8242dcba6590.htm\u0000317","EntityFrameworkDynamicQueryableExtensions.AnyAsync Method\u0000html/eeb7efeb-654f-1951-4973-cf8d1430fd87.htm\u000086","DefaultDynamicLinqCustomTypeProvider.ResolveTypeBySimpleName Method (String)\u0000html/f356f997-5773-4fd2-803d-e50394851752.htm\u0000117","EntityFrameworkDynamicQueryableExtensions.CountAsync Method (IQueryable, CancellationToken, String, Object[])\u0000html/ceadcc45-8df3-c8dd-c45c-6ea1f855fb15.htm\u0000321","DynamicQueryableExtensions.ThenBy Method (IOrderedQueryable, String, Object[])\u0000html/b69b4248-5dce-88d7-5ea3-07e4da6647db.htm\u0000306","GroupResult.Key Property\u0000html/de13f53d-3367-2ef2-0efd-37dba00f10d1.htm\u000077","EntityFrameworkDynamicQueryableExtensions.CountAsync Method (IQueryable, CancellationToken)\u0000html/d0fc02c8-c1bf-7620-0787-66e6a608753c.htm\u0000253","DynamicClass Class\u0000html/e342c1b4-0ab2-9ff9-bbcb-78004b2d924d.htm\u0000315","DynamicQueryableExtensions.Cast Method (IQueryable, String)\u0000html/d8a7dbfa-e517-7494-426e-d054bd0b1181.htm\u0000205","EntityFrameworkDynamicQueryableExtensions.AnyAsync Method (IQueryable, String, Object[])\u0000html/e2269313-2cf3-821c-7384-180bde38df88.htm\u0000300","DynamicQueryableExtensions.Take Method\u0000html/d484c034-9f69-29ca-2643-5b8b0c31b76f.htm\u0000194","Page Not Found\u0000html/PageNotFound.htm\u000075","DynamicQueryableExtensions.DefaultIfEmpty Method (IQueryable)\u0000html/e0ca6de4-6275-a440-a2e6-673c389eb912.htm\u0000208","DynamicQueryableExtensions.Page Method\u0000html/e050a329-ded5-b6ad-bee5-bdcb2a97c5ee.htm\u000055","DynamicClass.GetDynamicPropertyValue Method (String)\u0000html/fa3df61c-afaa-9066-2395-c55a3694f0ac.htm\u000094","DynamicClass.GetDynamicPropertyValue(T) Method (String)\u0000html/de483a9a-bbaa-c976-2d1e-c568f8a0f6f4.htm\u0000102","DynamicEnumerableExtensions Methods\u0000html/fbeffa2b-5391-c0ef-59a5-cff1df0eb0b4.htm\u000088","IAssemblyHelper Interface\u0000html/f7d5f52e-c819-340a-3fc4-9aa80263945a.htm\u0000105","DynamicQueryableExtensions.Single Method (IQueryable)\u0000html/fe6a70ac-d69c-e985-17ee-46b522d89000.htm\u0000187","DynamicProperty Class\u0000html/e7f88c42-6076-1782-76c7-7f00bb2ba6b4.htm\u0000226","EntityFrameworkDynamicQueryableExtensions Class\u0000html/52258a68-c6cd-eb94-f06c-ff2564b46af9.htm\u0000777","DynamicExpressionParser.ParseLambda(T, TResult) Method (Void, Func(T, TResult), ParsingConfig, Boolean)\u0000html/aa03af81-60f2-59e1-1323-38d89a865c13.htm\u0000479","ParsingConfig.EvaluateGroupByAtDatabase Property\u0000html/fedbfe40-b8a1-0d02-3781-679de45a1aaf.htm\u0000142","General Error\u0000html/GeneralError.htm\u000041","DynamicQueryableExtensions.GroupBy Method (IQueryable, String, String)\u0000html/e2378abf-9ba7-31b2-2611-2a470fc31a9c.htm\u0000287","DynamicQueryableExtensions.Select Method (IQueryable, ParsingConfig, String, Object[])\u0000html/edf69e8b-5fef-a4e6-8b8b-ccf9cd04ddfb.htm\u0000299","EntityFrameworkDynamicQueryableExtensions.LastOrDefaultAsync Method (IQueryable, String, Object[])\u0000html/d3442954-d871-8253-7c6c-f8f01a7d3119.htm\u0000341","DynamicQueryableExtensions.Page(TSource) Method (Void, TSource, IQueryable)\u0000html/f0a20829-2dee-5e5c-1988-4ca782990edf.htm\u0000371","DynamicClassFactory.CreateType Method\u0000html/a25424f0-7800-a591-fd75-1937b7d2df64.htm\u0000435","DynamicQueryableExtensions.Last Method (IQueryable)\u0000html/eb868b13-25d4-41fb-a03f-4033e93156ab.htm\u0000170","ParsingConfig.AreContextKeywordsEnabled Property\u0000html/e8e7f714-ca50-7fe7-256f-e8f54169fc8b.htm\u0000123","EntityFrameworkDynamicQueryableExtensions.FirstOrDefaultAsync Method (IQueryable, CancellationToken)\u0000html/f2ea5189-2610-6bae-9913-0aa54dde1bfe.htm\u0000268","DynamicLinqTypeAttribute Class\u0000html/f3787db5-ab98-db68-694e-94d2ddd8b140.htm\u0000272","ParsingConfig.QueryableAnalyzer Property\u0000html/b77a8f50-8987-c0d1-3b6f-4bd016c87751.htm\u000080","IExpressionPromoter Methods\u0000html/e57952b7-44ac-6a64-264d-6da3aea7093e.htm\u000042","DynamicEnumerableExtensions.ToDynamicList Method (Void)\u0000html/fcd0a2b5-6940-b38e-44c0-4340c6c77000.htm\u0000212","DynamicQueryableExtensions.Select Method (IQueryable, ParsingConfig, Type, String, Object[])\u0000html/fce0a87e-6632-055c-a4fe-d76c501a15c4.htm\u0000310","DynamicQueryableExtensions.SingleOrDefault Method (IQueryable)\u0000html/fb61a659-6588-79ea-a8c0-9a6d9d3cf1c1.htm\u0000207","DynamicQueryableExtensions.LastOrDefault Method\u0000html/ee19ea95-08a2-85c3-0e1a-7c0ac93345dd.htm\u0000148","EntityFrameworkDynamicQueryableExtensions.FirstAsync Method (IQueryable, String, Object[])\u0000html/ef03b0ca-b4cf-915e-5e1b-364786bea222.htm\u0000293","PagedResult(TSource) Properties\u0000html/f8bf2a0a-9a63-8a01-4591-a46c51a49245.htm\u0000110","DynamicExpressionParser.ParseLambda(TResult) Method (Void, Func(TResult), ParsingConfig, Boolean)\u0000html/fe770dbc-3af7-16f9-5880-a5b384293307.htm\u0000401","AbstractDynamicLinqCustomTypeProvider Class\u0000html/a2968e7a-28c6-4e4a-97a7-bd7ce4b74499.htm\u0000290","DynamicQueryableExtensions.PageResult Method (IQueryable, Int32, Int32)\u0000html/a56645d1-6f20-cd49-ca71-6705862d3c0c.htm\u0000205","DynamicQueryableExtensions.GroupBy Method (IQueryable, ParsingConfig, String, String)\u0000html/ebc33bd5-9e6a-687c-613a-d0e80df20e3e.htm\u0000305","DynamicEnumerableAsyncExtensions.ToDynamicListAsync Method\u0000html/f4706713-1212-b813-600c-468d1315876e.htm\u000044","DynamicExpressionParser.ParseLambda Method (ParsingConfig, Type, Type, String, Object[])\u0000html/e5ce2140-397c-9e15-366d-bd68b4c2a748.htm\u0000214","DynamicEnumerableAsyncExtensions.ToDynamicListAsync(T) Method (Void)\u0000html/e6fe222f-ae62-f698-9ab1-f03c31c5d8ce.htm\u0000257","DynamicQueryableExtensions.ThenBy(TSource) Method (Void, TSource, IOrderedQueryable)\u0000html/ab68ddf5-0a51-c8e1-0749-2387ce71e6ff.htm\u0000372","PagedResult(TSource) Constructor\u0000html/fe1717f7-802b-f5a9-b54a-f764cd84365d.htm\u000070","System.Linq.Dynamic.Core.Parser Namespace\u0000html/ebe0037e-4a11-896a-6db2-f3601e9fba51.htm\u000071","IQueryableAnalyzer.SupportsLinqToObjects Method\u0000html/ee5bfae2-fceb-ddda-588c-6e9faa2d5ecd.htm\u0000120","Microsoft.EntityFrameworkCore.DynamicLinq Namespace\u0000html/f553b938-f70f-c9bd-8e29-682200413e96.htm\u000094","DynamicQueryableExtensions.FirstOrDefault Method (IQueryable)\u0000html/f8c59313-dc93-0853-6228-867bda26dcc6.htm\u0000189","EntityFrameworkDynamicQueryableExtensions.FirstOrDefaultAsync Method (IQueryable, CancellationToken)\u0000html/ad4e3af4-79a0-24d7-96bb-4e9cc7318ecc.htm\u0000264","DynamicQueryableExtensions.SelectMany Method (IQueryable, ParsingConfig, String, String, String, String, Object[], Object[])\u0000html/b7ca9bf2-84db-0204-2362-61e9d90c9abe.htm\u0000437","IGrouping`2 Interface\u0000html/bba4962d-c071-c465-5c4e-75754a7ad9bb.htm\u000064","DynamicQueryableExtensions.OfType Method (IQueryable, ParsingConfig, String)\u0000html/ee97fc17-7c9a-a908-fa49-215f372075a8.htm\u0000219","EntityFrameworkDynamicQueryableExtensions.FirstAsync Method\u0000html/bd57e5da-91f3-3386-eb56-0945ca4e6df8.htm\u000089","ParsingConfig.ExpressionPromoter Property\u0000html/bd69785a-e783-d570-a543-44cbdd263af5.htm\u000080","EntityFrameworkDynamicQueryableExtensions.LastAsync Method (IQueryable, CancellationToken, String, Object[])\u0000html/ecd48c4e-c134-0bf9-c7f7-2cc2de7e15b0.htm\u0000335","DynamicQueryableExtensions.Select Method (IQueryable, Type, String, Object[])\u0000html/f9de96fd-6adf-74d0-4a13-c82fbea3d236.htm\u0000292","EntityFrameworkDynamicQueryableExtensions.FirstAsync Method (IQueryable, String, Object[])\u0000html/adefc6a7-8218-9f28-b97d-48af4d437fca.htm\u0000289","DynamicQueryableExtensions.Reverse Method\u0000html/b0e704dc-35d9-b829-65eb-5c8ca6457ba9.htm\u0000174","DynamicQueryableExtensions.GroupByMany(TElement) Method (IEnumerable(TElement), Func(TElement, Object)[])\u0000html/f568b7f3-a69a-6a6d-700e-5e2db2eaa795.htm\u0000265","DynamicExpressionParser.ParseLambda Method (ParsingConfig, Type, String, Object[])\u0000html/ecf9b2a9-9a1e-1041-3a47-e1ce4b4492e8.htm\u0000194","DynamicQueryableExtensions.DefaultIfEmpty Method (IQueryable, Object)\u0000html/f64df3a8-684e-a8a7-362d-5f6b4e903bac.htm\u0000233","DefaultDynamicLinqCustomTypeProvider.ResolveType Method (String)\u0000html/f650cd15-ec57-45ba-d742-226d40cd37e6.htm\u0000115","DynamicEnumerableAsyncExtensions Class\u0000html/f6fd3b5a-3d2f-fc65-c489-4d161f6f3072.htm\u0000138","EntityFrameworkDynamicQueryableExtensions Class\u0000html/ed7f1515-c1bd-5914-ff3d-a11c448e1288.htm\u0000782","IDynamicLinkCustomTypeProvider Interface\u0000html/ed8ecef6-0089-eab6-3c3c-e76b190ea7e8.htm\u0000130","DynamicQueryableExtensions Class\u0000html/a5ecbe15-aade-af7f-4860-6c5c412a34b4.htm\u00002583","DynamicQueryableExtensions.PageResult Method\u0000html/a8ba3814-05f4-78f5-3342-df80bc14992c.htm\u000065"]
\ No newline at end of file
diff --git a/docs/html/00382765-2e26-f538-4a2d-b2485efd1a8e.htm b/docs/html/00382765-2e26-f538-4a2d-b2485efd1a8e.htm
deleted file mode 100644
index 7c8c657d8..000000000
--- a/docs/html/00382765-2e26-f538-4a2d-b2485efd1a8e.htm
+++ /dev/null
@@ -1,22 +0,0 @@
-
ParseException Class
- Represents errors that occur while parsing dynamic linq string expressions.
-
Inheritance Hierarchy
-
Namespace:
-
System.Linq.Dynamic.Core.Exceptions
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax[SerializableAttribute ]
-public sealed class ParseException : Exception The ParseException type exposes the following members.
Constructors
-
- Name Description ParseException
- Initializes a new instance of the ParseException class with a specified error message and position.
-
Top Properties
-
- Name Description Data Gets a collection of key/value pairs that provide additional user-defined information about the exception.
(Inherited from Exception .)HelpLink Gets or sets a link to the help file associated with this exception.
(Inherited from Exception .)HResult Gets or sets HRESULT, a coded numerical value that is assigned to a specific exception.
(Inherited from Exception .)InnerException Gets the
Exception instance that caused the current exception.
(Inherited from Exception .)Message Gets a message that describes the current exception.
(Inherited from Exception .)Position
- The location in the parsed string that produced the ParseException .
-
Source Gets or sets the name of the application or the object that causes the error.
(Inherited from Exception .)StackTrace Gets a string representation of the immediate frames on the call stack.
(Inherited from Exception .)TargetSite Gets the method that throws the current exception.
(Inherited from Exception .)
Top Methods See Also
\ No newline at end of file
diff --git a/docs/html/0147cbd2-56f7-960b-ff12-eeebdd444632.htm b/docs/html/0147cbd2-56f7-960b-ff12-eeebdd444632.htm
deleted file mode 100644
index 9053583b8..000000000
--- a/docs/html/0147cbd2-56f7-960b-ff12-eeebdd444632.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
ExpressionParser.Parse Method ExpressionParser Parse Method
- Uses the TextParser to parse the string into the specified result type.
-
-
Namespace:
-
System.Linq.Dynamic.Core.Parser
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic Expression Parse (
- Type resultType ,
- bool createParameterCtor = true
-)Parameters resultType Type: System Type Type of the result. createParameterCtor (Optional)Type: System Boolean if set to true [create parameter ctor]. Return Value Type:
Expression Expression
See Also
\ No newline at end of file
diff --git a/docs/html/0173022b-87b8-41c9-4857-667145b06553.htm b/docs/html/0173022b-87b8-41c9-4857-667145b06553.htm
deleted file mode 100644
index edf97c9e1..000000000
--- a/docs/html/0173022b-87b8-41c9-4857-667145b06553.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.OrderBy(TSource) Method (Void, TSource, IQueryable, Void) DynamicQueryableExtensions OrderByTSource Method (Void, TSource , IQueryable, Void)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.OrderBy``1(System.Void,``0,System.Linq.IQueryable`1,System.Void)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IOrderedQueryable OrderBy <TSource>(
- this void source ,
- TSource config ,
- IQueryable ordering ,
- params void args
-)
-Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.OrderBy``1(System.Void,``0,System.Linq.IQueryable`1,System.Void)"]
config Type: TSource [Missing <param name="config"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.OrderBy``1(System.Void,``0,System.Linq.IQueryable`1,System.Void)"]
ordering Type: System.Linq IQueryable T [Missing <param name="ordering"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.OrderBy``1(System.Void,``0,System.Linq.IQueryable`1,System.Void)"]
args Type: System Void [Missing <param name="args"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.OrderBy``1(System.Void,``0,System.Linq.IQueryable`1,System.Void)"]
Type Parameters TSource [Missing <typeparam name="TSource"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.OrderBy``1(System.Void,``0,System.Linq.IQueryable`1,System.Void)"]
Return Value Type:
IOrderedQueryable T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.OrderBy``1(System.Void,``0,System.Linq.IQueryable`1,System.Void)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/024bfd5b-b503-081f-f322-bba29b0db820.htm b/docs/html/024bfd5b-b503-081f-f322-bba29b0db820.htm
deleted file mode 100644
index c31e08246..000000000
--- a/docs/html/024bfd5b-b503-081f-f322-bba29b0db820.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.Last Method DynamicQueryableExtensions Last Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/02b9674f-9507-89ed-6075-ac4bb10306cb.htm b/docs/html/02b9674f-9507-89ed-6075-ac4bb10306cb.htm
deleted file mode 100644
index 2a3ff7291..000000000
--- a/docs/html/02b9674f-9507-89ed-6075-ac4bb10306cb.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
AbstractDynamicLinqCustomTypeProvider Constructor AbstractDynamicLinqCustomTypeProvider Constructor
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxprotected AbstractDynamicLinqCustomTypeProvider () See Also
\ No newline at end of file
diff --git a/docs/html/034ae87e-3b08-4832-3d16-21f20a6e540f.htm b/docs/html/034ae87e-3b08-4832-3d16-21f20a6e540f.htm
deleted file mode 100644
index 8981a3d5e..000000000
--- a/docs/html/034ae87e-3b08-4832-3d16-21f20a6e540f.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
GroupResult Properties The GroupResult type exposes the following members.
Properties
-
- Name Description Count
- The number of resulting elements in the group.
-
Items
- The resulting elements in the group.
-
Key
- The key value of the group.
-
Subgroups
- The resulting subgroups in the group.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/040bf9ea-b9bb-5e93-5ebf-69bd1920b899.htm b/docs/html/040bf9ea-b9bb-5e93-5ebf-69bd1920b899.htm
deleted file mode 100644
index 7397d0cc6..000000000
--- a/docs/html/040bf9ea-b9bb-5e93-5ebf-69bd1920b899.htm
+++ /dev/null
@@ -1,22 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.FirstOrDefaultAsync Method (IQueryable, String, Object[]) EntityFrameworkDynamicQueryableExtensions FirstOrDefaultAsync Method (IQueryable, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition
- or a default value if no such element is found.
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > FirstOrDefaultAsync (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the first element of.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation.
- The task result contains
default if
source
- is empty or if no element passes the test specified by
predicate ; otherwise, the first
- element in
source that passes the test specified by
predicate .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/0468cae0-2fa0-3b7f-e933-61344ae24785.htm b/docs/html/0468cae0-2fa0-3b7f-e933-61344ae24785.htm
deleted file mode 100644
index 9ff2339c7..000000000
--- a/docs/html/0468cae0-2fa0-3b7f-e933-61344ae24785.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicEnumerableAsyncExtensions.ToDynamicArrayAsync Method (IEnumerable, Type) DynamicEnumerableAsyncExtensions ToDynamicArrayAsync Method (IEnumerable, Type)
- Async creates an array of dynamic objects from a
IEnumerable .
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/059ea426-8283-f2ce-2fe8-a888fb9dfcc6.htm b/docs/html/059ea426-8283-f2ce-2fe8-a888fb9dfcc6.htm
deleted file mode 100644
index e3adcfae3..000000000
--- a/docs/html/059ea426-8283-f2ce-2fe8-a888fb9dfcc6.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
DynamicQueryableExtensions.TakeWhile Method DynamicQueryableExtensions TakeWhile Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/06f2e254-4629-ab9e-f08a-f7ada79ad522.htm b/docs/html/06f2e254-4629-ab9e-f08a-f7ada79ad522.htm
deleted file mode 100644
index 06d1785de..000000000
--- a/docs/html/06f2e254-4629-ab9e-f08a-f7ada79ad522.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
AbstractDynamicLinqCustomTypeProvider.ResolveTypeBySimpleName Method AbstractDynamicLinqCustomTypeProvider ResolveTypeBySimpleName Method
- Resolve a type by the simple name which is registered in the current application domain.
-
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/07acb50b-7caf-5314-ac76-1208f447580a.htm b/docs/html/07acb50b-7caf-5314-ac76-1208f447580a.htm
deleted file mode 100644
index 459b33138..000000000
--- a/docs/html/07acb50b-7caf-5314-ac76-1208f447580a.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicExpressionParser.ParseLambda Method (Boolean, ParameterExpression[], Type, String, Object[])
DynamicExpressionParser ParseLambda Method (Boolean, ParameterExpression , Type, String, Object )
- Parses an expression into a LambdaExpression.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static LambdaExpression ParseLambda (
- bool createParameterCtor ,
- ParameterExpression [] parameters ,
- Type resultType ,
- string expression ,
- params Object [] values
-)Parameters createParameterCtor Type: System Boolean if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. parameters Type: System.Linq.Expressions ParameterExpression A array from ParameterExpressions. resultType Type: System Type Type of the result. If not specified, it will be generated dynamically. expression Type: System String The expression. values Type: System Object An object array that contains zero or more objects which are used as replacement values. Return Value Type:
LambdaExpression The generated
LambdaExpression See Also
\ No newline at end of file
diff --git a/docs/html/07e31581-5ef6-08c7-0908-ced5c957e39f.htm b/docs/html/07e31581-5ef6-08c7-0908-ced5c957e39f.htm
deleted file mode 100644
index fa0730fff..000000000
--- a/docs/html/07e31581-5ef6-08c7-0908-ced5c957e39f.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
PagedResult(TSource).Queryable Property PagedResultTSource Queryable Property
- Gets or sets the queryable.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic IQueryable Queryable { get ; set ; }Property Value Type:
IQueryable T
- The queryable.
-
See Also
\ No newline at end of file
diff --git a/docs/html/08613265-5a58-a33f-3f89-f07332409549.htm b/docs/html/08613265-5a58-a33f-3f89-f07332409549.htm
deleted file mode 100644
index b6977213c..000000000
--- a/docs/html/08613265-5a58-a33f-3f89-f07332409549.htm
+++ /dev/null
@@ -1,15 +0,0 @@
-
DynamicQueryableExtensions.GroupBy Method (IQueryable, ParsingConfig, String, String, Object[]) DynamicQueryableExtensions GroupBy Method (IQueryable, ParsingConfig, String, String, Object )
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax Examplesvar groupResult1 = queryable.GroupBy("NumberPropertyAsKey" , "StringProperty" );
-var groupResult2 = queryable.GroupBy("new (NumberPropertyAsKey, StringPropertyAsKey)" , "new (StringProperty1, StringProperty2)" ); See Also
\ No newline at end of file
diff --git a/docs/html/0895ca9a-b605-7a25-c782-11e855864eb5.htm b/docs/html/0895ca9a-b605-7a25-c782-11e855864eb5.htm
deleted file mode 100644
index 8c65e89ba..000000000
--- a/docs/html/0895ca9a-b605-7a25-c782-11e855864eb5.htm
+++ /dev/null
@@ -1,22 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.SingleOrDefaultAsync Method (IQueryable, CancellationToken, String, Object[]) EntityFrameworkDynamicQueryableExtensions SingleOrDefaultAsync Method (IQueryable, CancellationToken, String, Object )
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > SingleOrDefaultAsync (
- this IQueryable source ,
- CancellationToken cancellationToken ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the single element of.
- cancellationToken Type: System.Threading CancellationToken
- A CancellationToken to observe while waiting for the task to complete.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation. The task result contains the single element of the input sequence that satisfies the condition in
predicate , or default if no such element is found.
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/0949ca7b-63c6-318d-93de-6d1daeb05ac6.htm b/docs/html/0949ca7b-63c6-318d-93de-6d1daeb05ac6.htm
deleted file mode 100644
index 2a1325e78..000000000
--- a/docs/html/0949ca7b-63c6-318d-93de-6d1daeb05ac6.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
ExpressionParser Constructor ExpressionParser Constructor
-
Namespace:
-
System.Linq.Dynamic.Core.Parser
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/096e6ff0-87d8-1e79-18f5-203f368fc5e8.htm b/docs/html/096e6ff0-87d8-1e79-18f5-203f368fc5e8.htm
deleted file mode 100644
index af678b4d1..000000000
--- a/docs/html/096e6ff0-87d8-1e79-18f5-203f368fc5e8.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
AbstractDynamicLinqCustomTypeProvider Methods AbstractDynamicLinqCustomTypeProvider Methods
The AbstractDynamicLinqCustomTypeProvider type exposes the following members.
Methods See Also
\ No newline at end of file
diff --git a/docs/html/09b1326f-d20c-fb04-9f6b-df23ec45a175.htm b/docs/html/09b1326f-d20c-fb04-9f6b-df23ec45a175.htm
deleted file mode 100644
index 9fc1279d4..000000000
--- a/docs/html/09b1326f-d20c-fb04-9f6b-df23ec45a175.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicQueryableExtensions.Select Method DynamicQueryableExtensions Select Method
Overload List
-
- Name Description Select(IQueryable, String, Object )
- Projects each element of a sequence into a new form.
-
Select TResult (Void, TResult, IQueryable) Select(IQueryable, ParsingConfig, String, Object )
- Projects each element of a sequence into a new form.
-
Select(IQueryable, Type, String, Object )
- Projects each element of a sequence into a new class of type TResult.
- Details see http://solutionizing.net/category/linq/
-
Select TResult (Void, TResult, IQueryable, ParsingConfig) Select(IQueryable, ParsingConfig, Type, String, Object )
- Projects each element of a sequence into a new class of type TResult.
- Details see http://solutionizing.net/category/linq/
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/09c64b73-29db-e275-a4af-2731ed091dc5.htm b/docs/html/09c64b73-29db-e275-a4af-2731ed091dc5.htm
deleted file mode 100644
index c5210eb6a..000000000
--- a/docs/html/09c64b73-29db-e275-a4af-2731ed091dc5.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicQueryableExtensions.Where Method DynamicQueryableExtensions Where Method
Overload List
-
- Name Description Where(IQueryable, LambdaExpression)
- Filters a sequence of values based on a predicate.
-
Where(IQueryable, String, Object )
- Filters a sequence of values based on a predicate.
-
Where TSource (Void, TSource, IQueryable T ) Where(IQueryable, ParsingConfig, String, Object )
- Filters a sequence of values based on a predicate.
-
Where TSource (Void, TSource, IQueryable T , Void)
Top See Also
\ No newline at end of file
diff --git a/docs/html/0aaa4b1b-f43a-d77c-3162-4702efe6d1e0.htm b/docs/html/0aaa4b1b-f43a-d77c-3162-4702efe6d1e0.htm
deleted file mode 100644
index d4d52e5a0..000000000
--- a/docs/html/0aaa4b1b-f43a-d77c-3162-4702efe6d1e0.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.OfType Method (IQueryable, String) DynamicQueryableExtensions OfType Method (IQueryable, String)
- Filters the elements of an
IQueryable based on a specified type.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/0b04dca9-60bd-34ab-b18e-03a98bde0479.htm b/docs/html/0b04dca9-60bd-34ab-b18e-03a98bde0479.htm
deleted file mode 100644
index 5bab3898d..000000000
--- a/docs/html/0b04dca9-60bd-34ab-b18e-03a98bde0479.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
DynamicQueryableExtensions.SelectMany Method (IQueryable, String, String, Object[], Object[]) DynamicQueryableExtensions SelectMany Method (IQueryable, String, String, Object , Object )
- Projects each element of a sequence to an
IQueryable
- and invokes a result selector function on each element therein. The resulting
- values from each intermediate sequence are combined into a single, one-dimensional
- sequence and returned.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable SelectMany (
- this IQueryable source ,
- string collectionSelector ,
- string resultSelector ,
- Object [] collectionSelectorArgs = null ,
- params Object [] resultSelectorArgs
-)Parameters source Type: System.Linq IQueryable A sequence of values to project. collectionSelector Type: System String A projection function to apply to each element of the input sequence. resultSelector Type: System String A projection function to apply to each element of each intermediate sequence. collectionSelectorArgs (Optional)Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. resultSelectorArgs Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable
- An
IQueryable whose elements are the result of invoking the one-to-many
- projection function
collectionSelector on each element of source and then mapping
- each of those sequence elements and their corresponding source element to a result element.
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Examples See Also
\ No newline at end of file
diff --git a/docs/html/0b9fe7fa-93b0-c57f-9921-9f61263dcd9f.htm b/docs/html/0b9fe7fa-93b0-c57f-9921-9f61263dcd9f.htm
deleted file mode 100644
index ff0a20eb5..000000000
--- a/docs/html/0b9fe7fa-93b0-c57f-9921-9f61263dcd9f.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
ParsingConfig.DisableMemberAccessToIndexAccessorFallback Property ParsingConfig DisableMemberAccessToIndexAccessorFallback Property
- By default when a member is not found in a type and the type has a string based index accessor it will be parsed as an index accessor. Use
- this flag to disable this behaviour and have parsing fail when parsing an expression
- where a member access on a non existing member happens. Default value is false.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic bool DisableMemberAccessToIndexAccessorFallback { get ; set ; }Property Value Type:
Boolean See Also
\ No newline at end of file
diff --git a/docs/html/0bc0206d-0724-3891-b8d5-51c48abff2eb.htm b/docs/html/0bc0206d-0724-3891-b8d5-51c48abff2eb.htm
deleted file mode 100644
index 34e3dd22a..000000000
--- a/docs/html/0bc0206d-0724-3891-b8d5-51c48abff2eb.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.LastAsync Method EntityFrameworkDynamicQueryableExtensions LastAsync Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/0c8043a5-5a1f-ed54-2d3b-8ad523c727af.htm b/docs/html/0c8043a5-5a1f-ed54-2d3b-8ad523c727af.htm
deleted file mode 100644
index 2430c974d..000000000
--- a/docs/html/0c8043a5-5a1f-ed54-2d3b-8ad523c727af.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.SingleOrDefaultAsync Method EntityFrameworkDynamicQueryableExtensions SingleOrDefaultAsync Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/0cc7935a-094f-b630-5475-1805945d5ae6.htm b/docs/html/0cc7935a-094f-b630-5475-1805945d5ae6.htm
deleted file mode 100644
index 6a6cc398d..000000000
--- a/docs/html/0cc7935a-094f-b630-5475-1805945d5ae6.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.Aggregate Method DynamicQueryableExtensions Aggregate Method
- Dynamically runs an aggregate function on the IQueryable.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static Object Aggregate (
- this IQueryable source ,
- string function ,
- string member
-)Parameters source Type: System.Linq IQueryable The IQueryable data source. function Type: System String The name of the function to run. Can be Sum, Average, Min or Max. member Type: System String The name of the property to aggregate over. Return Value Type:
Object The value of the aggregate function run over the specified property.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/0d0f8f36-4caf-0843-b34b-2bf738526b51.htm b/docs/html/0d0f8f36-4caf-0843-b34b-2bf738526b51.htm
deleted file mode 100644
index 4e9c7f274..000000000
--- a/docs/html/0d0f8f36-4caf-0843-b34b-2bf738526b51.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
DefaultQueryableAnalyzer Constructor DefaultQueryableAnalyzer Constructor
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic DefaultQueryableAnalyzer () See Also
\ No newline at end of file
diff --git a/docs/html/0e9009a8-cfed-c48e-51ad-e8d7d2dbd8d3.htm b/docs/html/0e9009a8-cfed-c48e-51ad-e8d7d2dbd8d3.htm
deleted file mode 100644
index 295b0a1e3..000000000
--- a/docs/html/0e9009a8-cfed-c48e-51ad-e8d7d2dbd8d3.htm
+++ /dev/null
@@ -1,205 +0,0 @@
-
DynamicQueryableExtensions Methods DynamicQueryableExtensions Methods
The DynamicQueryableExtensions type exposes the following members.
Methods
-
- Name Description Aggregate
- Dynamically runs an aggregate function on the IQueryable.
-
Any(IQueryable)
- Determines whether a sequence contains any elements.
-
Any(IQueryable, LambdaExpression)
- Determines whether a sequence contains any elements.
-
Any(IQueryable, String, Object )
- Determines whether a sequence contains any elements.
-
Any(IQueryable, ParsingConfig, String, Object )
- Determines whether a sequence contains any elements.
-
AsEnumerable Cast(IQueryable, String)
- Converts the elements of an
IQueryable to the specified type.
-
Cast(IQueryable, Type)
- Converts the elements of an
IQueryable to the specified type.
-
Cast(IQueryable, ParsingConfig, String)
- Converts the elements of an
IQueryable to the specified type.
-
Count(IQueryable)
- Returns the number of elements in a sequence.
-
Count(IQueryable, LambdaExpression)
- Returns the number of elements in a sequence.
-
Count(IQueryable, String, Object )
- Returns the number of elements in a sequence.
-
Count(IQueryable, ParsingConfig, String, Object )
- Returns the number of elements in a sequence.
-
DefaultIfEmpty(IQueryable)
- Returns the elements of the specified sequence or the type parameter's default value in a singleton collection if the sequence is empty.
-
DefaultIfEmpty(IQueryable, Object)
- Returns the elements of the specified sequence or the type parameter's default value in a singleton collection if the sequence is empty.
-
Distinct
- Returns distinct elements from a sequence by using the default equality comparer to compare values.
-
First(IQueryable)
- Returns the first element of a sequence.
-
First(IQueryable, LambdaExpression)
- Returns the first element of a sequence that satisfies a specified condition.
-
First(IQueryable, String, Object )
- Returns the first element of a sequence that satisfies a specified condition.
-
First(IQueryable, ParsingConfig, String, Object )
- Returns the first element of a sequence that satisfies a specified condition.
-
FirstOrDefault(IQueryable)
- Returns the first element of a sequence, or a default value if the sequence contains no elements.
-
FirstOrDefault(IQueryable, LambdaExpression)
- Returns the first element of a sequence that satisfies a specified condition or a default value if no such element is found.
-
FirstOrDefault(IQueryable, String, Object )
- Returns the first element of a sequence that satisfies a specified condition or a default value if no such element is found.
-
FirstOrDefault(IQueryable, ParsingConfig, String, Object )
- Returns the first element of a sequence that satisfies a specified condition or a default value if no such element is found.
-
GroupBy(IQueryable, String, Object )
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupBy(IQueryable, String, String)
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupBy(IQueryable, ParsingConfig, String, Object )
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupBy(IQueryable, ParsingConfig, String, String)
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupBy(IQueryable, String, String, Object )
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupBy(IQueryable, ParsingConfig, String, String, Object )
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupByMany TElement (IEnumerable TElement , Func TElement, Object )
- Groups the elements of a sequence according to multiple specified key functions
- and creates a result value from each group (and subgroups) and its key.
-
GroupByMany TElement (IEnumerable TElement , String )
- Groups the elements of a sequence according to multiple specified key string functions
- and creates a result value from each group (and subgroups) and its key.
-
GroupByMany TElement (IEnumerable TElement , ParsingConfig, String )
- Groups the elements of a sequence according to multiple specified key string functions
- and creates a result value from each group (and subgroups) and its key.
-
GroupJoin(IQueryable, IEnumerable, String, String, String, Object )
- Correlates the elements of two sequences based on equality of keys and groups the results. The default equality comparer is used to compare keys.
-
GroupJoin(IQueryable, ParsingConfig, IEnumerable, String, String, String, Object )
- Correlates the elements of two sequences based on equality of keys and groups the results. The default equality comparer is used to compare keys.
-
Join(IQueryable, IEnumerable, String, String, String, Object )
- Correlates the elements of two sequences based on matching keys. The default equality comparer is used to compare keys.
-
Join(IQueryable, ParsingConfig, IEnumerable, String, String, String, Object )
- Correlates the elements of two sequences based on matching keys. The default equality comparer is used to compare keys.
-
Join TElement (Void, TElement, IQueryable T , Void, TElement, IEnumerable TElement ) Join TElement (Void, TElement, IQueryable T , Void, TElement, ParsingConfig, IEnumerable TElement ) Last(IQueryable)
- Returns the last element of a sequence.
-
Last(IQueryable, LambdaExpression)
- Returns the last element of a sequence that satisfies a specified condition.
-
Last(IQueryable, String, Object )
- Returns the last element of a sequence that satisfies a specified condition.
-
Last(IQueryable, ParsingConfig, String, Object )
- Returns the last element of a sequence that satisfies a specified condition.
-
LastOrDefault(IQueryable)
- Returns the last element of a sequence, or a default value if the sequence contains no elements.
-
LastOrDefault(IQueryable, LambdaExpression)
- Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements.
-
LastOrDefault(IQueryable, String, Object )
- Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements.
-
LastOrDefault(IQueryable, ParsingConfig, String, Object )
- Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements.
-
OfType(IQueryable, String)
- Filters the elements of an
IQueryable based on a specified type.
-
OfType(IQueryable, Type)
- Filters the elements of an
IQueryable based on a specified type.
-
OfType(IQueryable, ParsingConfig, String)
- Filters the elements of an
IQueryable based on a specified type.
-
OrderBy(IQueryable, String, Object )
- Sorts the elements of a sequence in ascending or descending order according to a key.
-
OrderBy(IQueryable, ParsingConfig, String, Object )
- Sorts the elements of a sequence in ascending or descending order according to a key.
-
OrderBy TSource (Void, TSource, IQueryable T ) OrderBy TSource (Void, TSource, IQueryable T , Void) Page(IQueryable, Int32, Int32)
- Returns the elements as paged.
-
Page TSource (Void, TSource, IQueryable T ) PageResult(IQueryable, Int32, Int32)
- Returns the elements as paged and include the CurrentPage, PageCount, PageSize and RowCount.
-
PageResult TSource (IQueryable T , Void, TSource) Reverse
- Inverts the order of the elements in a sequence.
-
Select(IQueryable, String, Object )
- Projects each element of a sequence into a new form.
-
Select(IQueryable, ParsingConfig, String, Object )
- Projects each element of a sequence into a new form.
-
Select(IQueryable, Type, String, Object )
- Projects each element of a sequence into a new class of type TResult.
- Details see http://solutionizing.net/category/linq/
-
Select(IQueryable, ParsingConfig, Type, String, Object )
- Projects each element of a sequence into a new class of type TResult.
- Details see http://solutionizing.net/category/linq/
-
Select TResult (Void, TResult, IQueryable) Select TResult (Void, TResult, IQueryable, ParsingConfig) SelectMany(IQueryable, String, Object )
- Projects each element of a sequence to an
IQueryable and combines the resulting sequences into one sequence.
-
SelectMany(IQueryable, ParsingConfig, String, Object )
- Projects each element of a sequence to an
IQueryable and combines the resulting sequences into one sequence.
-
SelectMany(IQueryable, Type, String, Object )
- Projects each element of a sequence to an
IQueryable and combines the resulting sequences into one sequence.
-
SelectMany(IQueryable, ParsingConfig, Type, String, Object )
- Projects each element of a sequence to an
IQueryable and combines the resulting sequences into one sequence.
-
SelectMany(IQueryable, String, String, Object , Object )
- Projects each element of a sequence to an
IQueryable
- and invokes a result selector function on each element therein. The resulting
- values from each intermediate sequence are combined into a single, one-dimensional
- sequence and returned.
-
SelectMany(IQueryable, ParsingConfig, String, String, Object , Object )
- Projects each element of a sequence to an
IQueryable
- and invokes a result selector function on each element therein. The resulting
- values from each intermediate sequence are combined into a single, one-dimensional
- sequence and returned.
-
SelectMany(IQueryable, String, String, String, String, Object , Object )
- Projects each element of a sequence to an
IQueryable
- and invokes a result selector function on each element therein. The resulting
- values from each intermediate sequence are combined into a single, one-dimensional
- sequence and returned.
-
SelectMany(IQueryable, ParsingConfig, String, String, String, String, Object , Object )
- Projects each element of a sequence to an
IQueryable
- and invokes a result selector function on each element therein. The resulting
- values from each intermediate sequence are combined into a single, one-dimensional
- sequence and returned.
-
SelectMany TResult (Void, TResult, IQueryable) SelectMany TResult (Void, TResult, IQueryable, ParsingConfig) Single(IQueryable)
- Returns the only element of a sequence, and throws an exception if there
- is not exactly one element in the sequence.
-
Single(IQueryable, LambdaExpression)
- Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there
- is not exactly one element in the sequence.
-
Single(IQueryable, String, Object )
- Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there
- is not exactly one element in the sequence.
-
Single(IQueryable, ParsingConfig, String, Object )
- Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there
- is not exactly one element in the sequence.
-
SingleOrDefault(IQueryable)
- Returns the only element of a sequence, or a default value if the sequence
- is empty; this method throws an exception if there is more than one element
- in the sequence.
-
SingleOrDefault(IQueryable, LambdaExpression)
- Returns the only element of a sequence that satisfies a specified condition or a default value if the sequence
- is empty; and throws an exception if there is not exactly one element in the sequence.
-
SingleOrDefault(IQueryable, String, Object )
- Returns the only element of a sequence that satisfies a specified condition or a default value if the sequence
- is empty; and throws an exception if there is not exactly one element in the sequence.
-
SingleOrDefault(IQueryable, ParsingConfig, String, Object )
- Returns the only element of a sequence that satisfies a specified condition or a default value if the sequence
- is empty; and throws an exception if there is not exactly one element in the sequence.
-
Skip
- Bypasses a specified number of elements in a sequence and then returns the remaining elements.
-
SkipWhile(IQueryable, String, Object )
- Bypasses elements in a sequence as long as a specified condition is true and then returns the remaining elements.
-
SkipWhile(IQueryable, ParsingConfig, String, Object )
- Bypasses elements in a sequence as long as a specified condition is true and then returns the remaining elements.
-
Sum
- Computes the sum of a sequence of numeric values.
-
Take
- Returns a specified number of contiguous elements from the start of a sequence.
-
TakeWhile(IQueryable, String, Object )
- Returns elements from a sequence as long as a specified condition is true.
-
TakeWhile(IQueryable, ParsingConfig, String, Object )
- Returns elements from a sequence as long as a specified condition is true.
-
ThenBy(IOrderedQueryable, String, Object )
- Performs a subsequent ordering of the elements in a sequence in ascending order according to a key.
-
ThenBy(IOrderedQueryable, ParsingConfig, String, Object )
- Performs a subsequent ordering of the elements in a sequence in ascending order according to a key.
-
ThenBy TSource (Void, TSource, IOrderedQueryable T ) ThenBy TSource (Void, TSource, IOrderedQueryable T , Void) Where(IQueryable, LambdaExpression)
- Filters a sequence of values based on a predicate.
-
Where(IQueryable, String, Object )
- Filters a sequence of values based on a predicate.
-
Where(IQueryable, ParsingConfig, String, Object )
- Filters a sequence of values based on a predicate.
-
Where TSource (Void, TSource, IQueryable T ) Where TSource (Void, TSource, IQueryable T , Void)
Top See Also
\ No newline at end of file
diff --git a/docs/html/10746d82-d300-0ddf-3818-6c4f3e69a2d2.htm b/docs/html/10746d82-d300-0ddf-3818-6c4f3e69a2d2.htm
deleted file mode 100644
index 84de842d1..000000000
--- a/docs/html/10746d82-d300-0ddf-3818-6c4f3e69a2d2.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
IQueryableAnalyzer Interface IQueryableAnalyzer Interface
- Interface for QueryableAnalyzer.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic interface IQueryableAnalyzer The IQueryableAnalyzer type exposes the following members.
Methods
-
- Name Description SupportsLinqToObjects
- Determines whether the specified query (and provider) supports LinqToObjects.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/10a8e179-b946-1e70-1e92-c6ddb3f435ac.htm b/docs/html/10a8e179-b946-1e70-1e92-c6ddb3f435ac.htm
deleted file mode 100644
index e396675fd..000000000
--- a/docs/html/10a8e179-b946-1e70-1e92-c6ddb3f435ac.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicClass.TryGetMember Method DynamicClass TryGetMember Method
- Provides the implementation for operations that get member values. Classes derived from the
DynamicObject class can override this method to specify dynamic behavior for operations such as getting a value for a property.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic virtual bool TryGetMember (
- GetMemberBinder binder ,
- out Object result
-)Parameters binder Type: System.Dynamic GetMemberBinder Provides information about the object that called the dynamic operation. The binder.Name property provides the name of the member on which the dynamic operation is performed. For example, for the Console.WriteLine(sampleObject.SampleProperty) statement, where sampleObject is an instance of the class derived from the DynamicObject class, binder.Name returns "SampleProperty". The binder.IgnoreCase property specifies whether the member name is case-sensitive. result Type: System Object The result of the get operation. For example, if the method is called for a property, you can assign the property value to result . Return Value Type:
Boolean
- true if the operation is successful; otherwise, false. If this method returns false, the run-time binder of the language determines the behavior. (In most cases, a run-time exception is thrown.)
-
See Also
\ No newline at end of file
diff --git a/docs/html/10f9134f-6a1a-1160-0d58-e896f1aca0e7.htm b/docs/html/10f9134f-6a1a-1160-0d58-e896f1aca0e7.htm
deleted file mode 100644
index 70faa0d51..000000000
--- a/docs/html/10f9134f-6a1a-1160-0d58-e896f1aca0e7.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
ParsingConfig Constructor ParsingConfig Constructor
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/11a00ba7-3797-4af7-d1d1-9cc12dd6f4ac.htm b/docs/html/11a00ba7-3797-4af7-d1d1-9cc12dd6f4ac.htm
deleted file mode 100644
index 1c75f2617..000000000
--- a/docs/html/11a00ba7-3797-4af7-d1d1-9cc12dd6f4ac.htm
+++ /dev/null
@@ -1,15 +0,0 @@
-
DynamicQueryableExtensions.GroupJoin Method (IQueryable, ParsingConfig, IEnumerable, String, String, String, Object[]) DynamicQueryableExtensions GroupJoin Method (IQueryable, ParsingConfig, IEnumerable, String, String, String, Object )
- Correlates the elements of two sequences based on equality of keys and groups the results. The default equality comparer is used to compare keys.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable GroupJoin (
- this IQueryable outer ,
- ParsingConfig config ,
- IEnumerable inner ,
- string outerKeySelector ,
- string innerKeySelector ,
- string resultSelector ,
- params Object [] args
-)Parameters outer Type: System.Linq IQueryable The first sequence to join. config Type: System.Linq.Dynamic.Core ParsingConfig The ParsingConfig . inner Type: System.Collections IEnumerable The sequence to join to the first sequence. outerKeySelector Type: System String A dynamic function to extract the join key from each element of the first sequence. innerKeySelector Type: System String A dynamic function to extract the join key from each element of the second sequence. resultSelector Type: System String A dynamic function to create a result element from an element from the first sequence and a collection of matching elements from the second sequence. args Type: System Object An object array that contains zero or more objects to insert into the predicates as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable An
IQueryable obtained by performing a grouped join on two sequences.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/1315ecfa-daa5-7b32-fe1f-2c457937d762.htm b/docs/html/1315ecfa-daa5-7b32-fe1f-2c457937d762.htm
deleted file mode 100644
index 51d0a3020..000000000
--- a/docs/html/1315ecfa-daa5-7b32-fe1f-2c457937d762.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.FirstOrDefault Method (IQueryable, String, Object[]) DynamicQueryableExtensions FirstOrDefault Method (IQueryable, String, Object )
- Returns the first element of a sequence that satisfies a specified condition or a default value if no such element is found.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static Object FirstOrDefault (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable The IQueryable to return the first element of. predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Object default if source is empty or if no element passes the test specified by predicate; otherwise, the first element in source that passes the test specified by predicate.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/132d20e8-30d9-a0a4-5124-5d1c13156303.htm b/docs/html/132d20e8-30d9-a0a4-5124-5d1c13156303.htm
deleted file mode 100644
index fbe659e37..000000000
--- a/docs/html/132d20e8-30d9-a0a4-5124-5d1c13156303.htm
+++ /dev/null
@@ -1,22 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.FirstOrDefaultAsync Method (IQueryable, String, Object[]) EntityFrameworkDynamicQueryableExtensions FirstOrDefaultAsync Method (IQueryable, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition
- or a default value if no such element is found.
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > FirstOrDefaultAsync (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the first element of.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation.
- The task result contains
default if
source
- is empty or if no element passes the test specified by
predicate ; otherwise, the first
- element in
source that passes the test specified by
predicate .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/133151c1-b3db-6f53-23fd-bca6b2c44d3e.htm b/docs/html/133151c1-b3db-6f53-23fd-bca6b2c44d3e.htm
deleted file mode 100644
index 05be8dcb5..000000000
--- a/docs/html/133151c1-b3db-6f53-23fd-bca6b2c44d3e.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.PageResult(TSource) Method (IQueryable, Void, TSource) DynamicQueryableExtensions PageResultTSource Method (IQueryable, Void, TSource )
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.PageResult``1(System.Linq.IQueryable`1,System.Void,``0)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static PagedResult <TSource> PageResult <TSource>(
- this IQueryable source ,
- void page ,
- TSource pageSize
-)
-Parameters source Type: System.Linq IQueryable T [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.PageResult``1(System.Linq.IQueryable`1,System.Void,``0)"]
page Type: System Void [Missing <param name="page"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.PageResult``1(System.Linq.IQueryable`1,System.Void,``0)"]
pageSize Type: TSource [Missing <param name="pageSize"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.PageResult``1(System.Linq.IQueryable`1,System.Void,``0)"]
Type Parameters TSource [Missing <typeparam name="TSource"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.PageResult``1(System.Linq.IQueryable`1,System.Void,``0)"]
Return Value Type:
PagedResult TSource [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.PageResult``1(System.Linq.IQueryable`1,System.Void,``0)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable T . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/144078bd-d1ad-bece-4daa-7fdd3a7ed7dc.htm b/docs/html/144078bd-d1ad-bece-4daa-7fdd3a7ed7dc.htm
deleted file mode 100644
index 2cad8a3e9..000000000
--- a/docs/html/144078bd-d1ad-bece-4daa-7fdd3a7ed7dc.htm
+++ /dev/null
@@ -1,15 +0,0 @@
-
EntityFramework.DynamicLinq Namespace EntityFramework.DynamicLinq Namespace
Dynamic Linq extensions for EntityFramework which adds Async support
Classes
-
- Class Description EntityFrameworkDynamicQueryableExtensions
- Provides a set of static Async methods for querying data structures that implement
IQueryable .
- It allows dynamic string based querying. Very handy when, at compile time, you don't know the type of queries that will be generated,
- or when downstream components only return column names to sort and filter by.
-
-
\ No newline at end of file
diff --git a/docs/html/1480a26f-ba4e-6757-f81e-a750cb6e84be.htm b/docs/html/1480a26f-ba4e-6757-f81e-a750cb6e84be.htm
deleted file mode 100644
index 5618294f6..000000000
--- a/docs/html/1480a26f-ba4e-6757-f81e-a750cb6e84be.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
DynamicQueryableExtensions.OrderBy Method DynamicQueryableExtensions OrderBy Method
Overload List
-
- Name Description OrderBy(IQueryable, String, Object )
- Sorts the elements of a sequence in ascending or descending order according to a key.
-
OrderBy TSource (Void, TSource, IQueryable T ) OrderBy(IQueryable, ParsingConfig, String, Object )
- Sorts the elements of a sequence in ascending or descending order according to a key.
-
OrderBy TSource (Void, TSource, IQueryable T , Void)
Top See Also
\ No newline at end of file
diff --git a/docs/html/180d2eba-43fc-bcd7-3179-f2e9dcbd6599.htm b/docs/html/180d2eba-43fc-bcd7-3179-f2e9dcbd6599.htm
deleted file mode 100644
index 74005730f..000000000
--- a/docs/html/180d2eba-43fc-bcd7-3179-f2e9dcbd6599.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
AbstractDynamicLinqCustomTypeProvider.FindTypesMarkedWithDynamicLinqTypeAttribute Method AbstractDynamicLinqCustomTypeProvider FindTypesMarkedWithDynamicLinqTypeAttribute Method
- Finds the unique types marked with DynamicLinqTypeAttribute.
-
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/19090cca-6242-f6f4-36b6-0be4edb8ca90.htm b/docs/html/19090cca-6242-f6f4-36b6-0be4edb8ca90.htm
deleted file mode 100644
index 0210b040b..000000000
--- a/docs/html/19090cca-6242-f6f4-36b6-0be4edb8ca90.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicQueryableExtensions.LastOrDefault Method (IQueryable) DynamicQueryableExtensions LastOrDefault Method (IQueryable)
- Returns the last element of a sequence, or a default value if the sequence contains no elements.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/19561d4b-7597-2bb0-d9ff-53b19c2a7b7d.htm b/docs/html/19561d4b-7597-2bb0-d9ff-53b19c2a7b7d.htm
deleted file mode 100644
index a7241d62a..000000000
--- a/docs/html/19561d4b-7597-2bb0-d9ff-53b19c2a7b7d.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicExpressionParser.ParseLambda Method (ParsingConfig, ParameterExpression[], Type, String, Object[]) DynamicExpressionParser ParseLambda Method (ParsingConfig, ParameterExpression , Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/19b5d1da-767b-33fa-2450-d623c55c4fc0.htm b/docs/html/19b5d1da-767b-33fa-2450-d623c55c4fc0.htm
deleted file mode 100644
index fee0c7425..000000000
--- a/docs/html/19b5d1da-767b-33fa-2450-d623c55c4fc0.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
DynamicProperty Properties DynamicProperty Properties
The DynamicProperty type exposes the following members.
Properties
-
- Name Description Name
- Gets the name from the property.
-
Type
- Gets the type from the property.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/1b52f8e5-8c07-3f7e-4cd0-00ab1b21b3df.htm b/docs/html/1b52f8e5-8c07-3f7e-4cd0-00ab1b21b3df.htm
deleted file mode 100644
index b3077b1a5..000000000
--- a/docs/html/1b52f8e5-8c07-3f7e-4cd0-00ab1b21b3df.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
DynamicQueryableExtensions.ThenBy Method DynamicQueryableExtensions ThenBy Method
Overload List
-
- Name Description ThenBy(IOrderedQueryable, String, Object )
- Performs a subsequent ordering of the elements in a sequence in ascending order according to a key.
-
ThenBy TSource (Void, TSource, IOrderedQueryable T ) ThenBy(IOrderedQueryable, ParsingConfig, String, Object )
- Performs a subsequent ordering of the elements in a sequence in ascending order according to a key.
-
ThenBy TSource (Void, TSource, IOrderedQueryable T , Void)
Top See Also
\ No newline at end of file
diff --git a/docs/html/1c6270c8-551c-bdc4-37e6-023e785edea4.htm b/docs/html/1c6270c8-551c-bdc4-37e6-023e785edea4.htm
deleted file mode 100644
index 94eb4f65c..000000000
--- a/docs/html/1c6270c8-551c-bdc4-37e6-023e785edea4.htm
+++ /dev/null
@@ -1,3 +0,0 @@
-
System.Linq Namespace [Missing <summary> documentation for "N:System.Linq"]
Interfaces
-
- Interface Description IGrouping`2 Represents a collection of objects that have a common key.
\ No newline at end of file
diff --git a/docs/html/1cb33c56-fbd0-7439-26e9-f955171a8aa2.htm b/docs/html/1cb33c56-fbd0-7439-26e9-f955171a8aa2.htm
deleted file mode 100644
index 960723c60..000000000
--- a/docs/html/1cb33c56-fbd0-7439-26e9-f955171a8aa2.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
GroupResult.Items Property GroupResult Items Property
- The resulting elements in the group.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic IEnumerable Items { get ; }Property Value Type:
IEnumerable See Also
\ No newline at end of file
diff --git a/docs/html/1cf4ec89-2692-7736-8791-f42cacc3c7d7.htm b/docs/html/1cf4ec89-2692-7736-8791-f42cacc3c7d7.htm
deleted file mode 100644
index d299e2032..000000000
--- a/docs/html/1cf4ec89-2692-7736-8791-f42cacc3c7d7.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
IAssemblyHelper Methods The IAssemblyHelper type exposes the following members.
Methods
-
- Name Description GetAssemblies
- Gets the assemblies that have been loaded into the execution context of this application domain.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/1e04daa1-5f80-6b39-c037-265c793bd6b8.htm b/docs/html/1e04daa1-5f80-6b39-c037-265c793bd6b8.htm
deleted file mode 100644
index 69e322dd3..000000000
--- a/docs/html/1e04daa1-5f80-6b39-c037-265c793bd6b8.htm
+++ /dev/null
@@ -1,16 +0,0 @@
-
DynamicQueryableExtensions.SingleOrDefault Method DynamicQueryableExtensions SingleOrDefault Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/1ea5b856-4a45-621d-07fb-8be44d84b059.htm b/docs/html/1ea5b856-4a45-621d-07fb-8be44d84b059.htm
deleted file mode 100644
index 51d2aa296..000000000
--- a/docs/html/1ea5b856-4a45-621d-07fb-8be44d84b059.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicQueryableExtensions.LastOrDefault Method (IQueryable, ParsingConfig, String, Object[]) DynamicQueryableExtensions LastOrDefault Method (IQueryable, ParsingConfig, String, Object )
- Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/21a732e6-735e-5b2d-765b-ba7931521dbe.htm b/docs/html/21a732e6-735e-5b2d-765b-ba7931521dbe.htm
deleted file mode 100644
index 0afa5da47..000000000
--- a/docs/html/21a732e6-735e-5b2d-765b-ba7931521dbe.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicQueryableExtensions.OrderBy Method (IQueryable, String, Object[]) DynamicQueryableExtensions OrderBy Method (IQueryable, String, Object )
- Sorts the elements of a sequence in ascending or descending order according to a key.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IOrderedQueryable OrderBy (
- this IQueryable source ,
- string ordering ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable A sequence of values to order. ordering Type: System String An expression string to indicate values to order by. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IOrderedQueryable A
IQueryable whose elements are sorted according to the specified
ordering .
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Examplesvar resultSingle = queryable.OrderBy("NumberProperty" );
-var resultSingleDescending = queryable.OrderBy("NumberProperty DESC" );
-var resultMultiple = queryable.OrderBy("NumberProperty, StringProperty DESC" ); See Also
\ No newline at end of file
diff --git a/docs/html/21b9dc8f-41ac-997f-6fc3-64351b5b1e67.htm b/docs/html/21b9dc8f-41ac-997f-6fc3-64351b5b1e67.htm
deleted file mode 100644
index 340cfaae5..000000000
--- a/docs/html/21b9dc8f-41ac-997f-6fc3-64351b5b1e67.htm
+++ /dev/null
@@ -1,3 +0,0 @@
-
PagedResult Methods The PagedResult type exposes the following members.
Methods
-
- Name Description Equals Determines whether the specified object is equal to the current object.
(Inherited from Object .)Finalize Allows an object to try to free resources and perform other cleanup operations before it is reclaimed by garbage collection.
(Inherited from Object .)GetHashCode Serves as the default hash function.
(Inherited from Object .)GetType Gets the
Type of the current instance.
(Inherited from Object .)MemberwiseClone Creates a shallow copy of the current
Object .
(Inherited from Object .)ToString Returns a string that represents the current object.
(Inherited from Object .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/2213dd4d-59f9-f837-5ab7-7866fd7fcf1e.htm b/docs/html/2213dd4d-59f9-f837-5ab7-7866fd7fcf1e.htm
deleted file mode 100644
index 05a122bca..000000000
--- a/docs/html/2213dd4d-59f9-f837-5ab7-7866fd7fcf1e.htm
+++ /dev/null
@@ -1,3 +0,0 @@
-
ParsingConfig Methods The ParsingConfig type exposes the following members.
Methods
-
- Name Description Equals Determines whether the specified object is equal to the current object.
(Inherited from Object .)Finalize Allows an object to try to free resources and perform other cleanup operations before it is reclaimed by garbage collection.
(Inherited from Object .)GetHashCode Serves as the default hash function.
(Inherited from Object .)GetType Gets the
Type of the current instance.
(Inherited from Object .)MemberwiseClone Creates a shallow copy of the current
Object .
(Inherited from Object .)ToString Returns a string that represents the current object.
(Inherited from Object .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/2230c785-24db-d017-a958-3d0fdd49ea71.htm b/docs/html/2230c785-24db-d017-a958-3d0fdd49ea71.htm
deleted file mode 100644
index a485b0437..000000000
--- a/docs/html/2230c785-24db-d017-a958-3d0fdd49ea71.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.FirstAsync Method (IQueryable, CancellationToken) EntityFrameworkDynamicQueryableExtensions FirstAsync Method (IQueryable, CancellationToken)
- Asynchronously returns the first element of a sequence.
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntax Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/2258d87b-2032-1d74-8e8a-b25377298a03.htm b/docs/html/2258d87b-2032-1d74-8e8a-b25377298a03.htm
deleted file mode 100644
index 2a6c92f7b..000000000
--- a/docs/html/2258d87b-2032-1d74-8e8a-b25377298a03.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DefaultQueryableAnalyzer Class DefaultQueryableAnalyzer Class
- Default implementation.
-
Inheritance HierarchySystem Object System.Linq.Dynamic.Core DefaultQueryableAnalyzer
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic class DefaultQueryableAnalyzer : IQueryableAnalyzer The DefaultQueryableAnalyzer type exposes the following members.
Constructors Methods
-
- Name Description Equals Determines whether the specified object is equal to the current object.
(Inherited from Object .)Finalize Allows an object to try to free resources and perform other cleanup operations before it is reclaimed by garbage collection.
(Inherited from Object .)GetHashCode Serves as the default hash function.
(Inherited from Object .)GetType Gets the
Type of the current instance.
(Inherited from Object .)MemberwiseClone Creates a shallow copy of the current
Object .
(Inherited from Object .)SupportsLinqToObjects
- Determines whether the specified query (and provider) supports LinqToObjects.
-
ToString Returns a string that represents the current object.
(Inherited from Object .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/229e1980-ce7c-a4b5-01e0-d73c4a4183ec.htm b/docs/html/229e1980-ce7c-a4b5-01e0-d73c4a4183ec.htm
deleted file mode 100644
index 9d83fb146..000000000
--- a/docs/html/229e1980-ce7c-a4b5-01e0-d73c4a4183ec.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.CountAsync Method EntityFrameworkDynamicQueryableExtensions CountAsync Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/234ce2a1-921c-bae8-19b0-7968f3c6c87e.htm b/docs/html/234ce2a1-921c-bae8-19b0-7968f3c6c87e.htm
deleted file mode 100644
index d420e2018..000000000
--- a/docs/html/234ce2a1-921c-bae8-19b0-7968f3c6c87e.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicQueryableExtensions.Select Method (IQueryable, String, Object[]) DynamicQueryableExtensions Select Method (IQueryable, String, Object )
- Projects each element of a sequence into a new form.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable Select (
- this IQueryable source ,
- string selector ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable A sequence of values to project. selector Type: System String A projection string expression to apply to each element. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable An
IQueryable whose elements are the result of invoking a projection string on each element of source.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Examplesvar singleField = queryable.Select("StringProperty" );
-var dynamicObject = queryable.Select("new (StringProperty1, StringProperty2 as OtherStringPropertyName)" ); See Also
\ No newline at end of file
diff --git a/docs/html/23c1d3a3-0db1-9fb1-fe3d-1204e502f9ee.htm b/docs/html/23c1d3a3-0db1-9fb1-fe3d-1204e502f9ee.htm
deleted file mode 100644
index e7f99f7c6..000000000
--- a/docs/html/23c1d3a3-0db1-9fb1-fe3d-1204e502f9ee.htm
+++ /dev/null
@@ -1,3 +0,0 @@
-
DynamicLinqTypeAttribute Methods DynamicLinqTypeAttribute Methods
The DynamicLinqTypeAttribute type exposes the following members.
Methods
-
- Name Description Equals Returns a value that indicates whether this instance is equal to a specified object.
(Inherited from Attribute .)GetHashCode Returns the hash code for this instance.
(Inherited from Attribute .)GetType Gets the
Type of the current instance.
(Inherited from Object .)IsDefaultAttribute When overridden in a derived class, indicates whether the value of this instance is the default value for the derived class.
(Inherited from Attribute .)Match When overridden in a derived class, returns a value that indicates whether this instance equals a specified object.
(Inherited from Attribute .)ToString Returns a string that represents the current object.
(Inherited from Object .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/243f0e8e-9609-2e8d-b088-2f3679df469f.htm b/docs/html/243f0e8e-9609-2e8d-b088-2f3679df469f.htm
deleted file mode 100644
index 3d35b8fca..000000000
--- a/docs/html/243f0e8e-9609-2e8d-b088-2f3679df469f.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
PagedResult.Queryable Property PagedResult Queryable Property
- Gets or sets the queryable.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic IQueryable Queryable { get ; set ; }Property Value Type:
IQueryable
- The queryable.
-
See Also
\ No newline at end of file
diff --git a/docs/html/254eb037-08b8-6908-73ec-06a9535b513e.htm b/docs/html/254eb037-08b8-6908-73ec-06a9535b513e.htm
deleted file mode 100644
index ac2874850..000000000
--- a/docs/html/254eb037-08b8-6908-73ec-06a9535b513e.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
PagedResult.CurrentPage Property PagedResult CurrentPage Property
- Gets or sets the current page.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic int CurrentPage { get ; set ; }Property Value Type:
Int32
- The current page.
-
See Also
\ No newline at end of file
diff --git a/docs/html/260726ba-bf01-9db4-357a-5910d424756e.htm b/docs/html/260726ba-bf01-9db4-357a-5910d424756e.htm
deleted file mode 100644
index edfcadfb5..000000000
--- a/docs/html/260726ba-bf01-9db4-357a-5910d424756e.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.Cast Method (IQueryable, ParsingConfig, String) DynamicQueryableExtensions Cast Method (IQueryable, ParsingConfig, String)
- Converts the elements of an
IQueryable to the specified type.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/2664d667-ed19-c646-54ed-c9db2d9ad553.htm b/docs/html/2664d667-ed19-c646-54ed-c9db2d9ad553.htm
deleted file mode 100644
index d3eb73e58..000000000
--- a/docs/html/2664d667-ed19-c646-54ed-c9db2d9ad553.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
DynamicClass Properties The DynamicClass type exposes the following members.
Properties
-
- Name Description Item
- Gets or sets the
Object with the specified name.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/26b0b5a3-247b-0209-4b7a-7ff8fb4c0c98.htm b/docs/html/26b0b5a3-247b-0209-4b7a-7ff8fb4c0c98.htm
deleted file mode 100644
index e199a686e..000000000
--- a/docs/html/26b0b5a3-247b-0209-4b7a-7ff8fb4c0c98.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.LastAsync Method (IQueryable, CancellationToken) EntityFrameworkDynamicQueryableExtensions LastAsync Method (IQueryable, CancellationToken)
- Asynchronously returns the last element of a sequence. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntax Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/276b19f7-dfb2-f52d-df4a-7e367f12b235.htm b/docs/html/276b19f7-dfb2-f52d-df4a-7e367f12b235.htm
deleted file mode 100644
index b6b0b2657..000000000
--- a/docs/html/276b19f7-dfb2-f52d-df4a-7e367f12b235.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicQueryableExtensions.SelectMany Method (IQueryable, ParsingConfig, Type, String, Object[]) DynamicQueryableExtensions SelectMany Method (IQueryable, ParsingConfig, Type, String, Object )
- Projects each element of a sequence to an
IQueryable and combines the resulting sequences into one sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable SelectMany (
- this IQueryable source ,
- ParsingConfig config ,
- Type resultType ,
- string selector ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable A sequence of values to project. config Type: System.Linq.Dynamic.Core ParsingConfig The ParsingConfig . resultType Type: System Type The result type. selector Type: System String A projection string expression to apply to each element. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable An
IQueryable whose elements are the result of invoking a one-to-many projection function on each element of the input sequence.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Examplesvar permissions = users.SelectMany(typeof (Permission), "Roles.SelectMany(Permissions)" ); See Also
\ No newline at end of file
diff --git a/docs/html/29287a92-5040-ef0a-3012-74071dbb18f6.htm b/docs/html/29287a92-5040-ef0a-3012-74071dbb18f6.htm
deleted file mode 100644
index e456ef5a6..000000000
--- a/docs/html/29287a92-5040-ef0a-3012-74071dbb18f6.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.FirstOrDefaultAsync Method EntityFrameworkDynamicQueryableExtensions FirstOrDefaultAsync Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/2ad5ed20-e833-50e0-d4fb-8e1d0a44229c.htm b/docs/html/2ad5ed20-e833-50e0-d4fb-8e1d0a44229c.htm
deleted file mode 100644
index f2791b8cf..000000000
--- a/docs/html/2ad5ed20-e833-50e0-d4fb-8e1d0a44229c.htm
+++ /dev/null
@@ -1,25 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.FirstOrDefaultAsync Method (IQueryable, CancellationToken, String, Object[]) EntityFrameworkDynamicQueryableExtensions FirstOrDefaultAsync Method (IQueryable, CancellationToken, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition
- or a default value if no such element is found.
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > FirstOrDefaultAsync (
- this IQueryable source ,
- CancellationToken cancellationToken ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the first element of.
- cancellationToken Type: System.Threading CancellationToken
- A CancellationToken to observe while waiting for the task to complete.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation.
- The task result contains
default if
source
- is empty or if no element passes the test specified by
predicate ; otherwise, the first
- element in
source that passes the test specified by
predicate .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/2adefda4-0a38-b90a-4c33-ec6bcab66e8d.htm b/docs/html/2adefda4-0a38-b90a-4c33-ec6bcab66e8d.htm
deleted file mode 100644
index e4c2caab2..000000000
--- a/docs/html/2adefda4-0a38-b90a-4c33-ec6bcab66e8d.htm
+++ /dev/null
@@ -1,19 +0,0 @@
-
System.Linq.Dynamic.Core.CustomTypeProviders Namespace System.Linq.Dynamic.Core.CustomTypeProviders Namespace
Interface for providing custom types for Dynamic Linq. (Like custom enums.)
Classes Interfaces
\ No newline at end of file
diff --git a/docs/html/2c9e76dc-968c-3560-149f-328975b10c91.htm b/docs/html/2c9e76dc-968c-3560-149f-328975b10c91.htm
deleted file mode 100644
index 0734ed6e2..000000000
--- a/docs/html/2c9e76dc-968c-3560-149f-328975b10c91.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
PagedResult.PageCount Property PagedResult PageCount Property
- Gets or sets the page count.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic int PageCount { get ; set ; }Property Value Type:
Int32
- The page count.
-
See Also
\ No newline at end of file
diff --git a/docs/html/2ccf5092-bded-c090-5e55-625fa7908d1f.htm b/docs/html/2ccf5092-bded-c090-5e55-625fa7908d1f.htm
deleted file mode 100644
index eff90bf9b..000000000
--- a/docs/html/2ccf5092-bded-c090-5e55-625fa7908d1f.htm
+++ /dev/null
@@ -1,22 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.LastOrDefaultAsync Method (IQueryable, String, Object[]) EntityFrameworkDynamicQueryableExtensions LastOrDefaultAsync Method (IQueryable, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition
- or a default value if no such element is found. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > LastOrDefaultAsync (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the last element of.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation.
- The task result contains
default if
source
- is empty or if no element passes the test specified by
predicate ; otherwise, the last
- element in
source that passes the test specified by
predicate .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/2d25accc-7354-7edc-1a2b-86ddd65740ce.htm b/docs/html/2d25accc-7354-7edc-1a2b-86ddd65740ce.htm
deleted file mode 100644
index eb9eacef5..000000000
--- a/docs/html/2d25accc-7354-7edc-1a2b-86ddd65740ce.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicProperty.Type Property DynamicProperty Type Property
- Gets the type from the property.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic Type Type { get ; }Property Value Type:
Type
- The type from the property.
-
See Also
\ No newline at end of file
diff --git a/docs/html/2e4513d7-4001-9937-6ff2-c88404490299.htm b/docs/html/2e4513d7-4001-9937-6ff2-c88404490299.htm
deleted file mode 100644
index 2cf433617..000000000
--- a/docs/html/2e4513d7-4001-9937-6ff2-c88404490299.htm
+++ /dev/null
@@ -1,14 +0,0 @@
-
DynamicQueryableExtensions.Join Method (IQueryable, IEnumerable, String, String, String, Object[]) DynamicQueryableExtensions Join Method (IQueryable, IEnumerable, String, String, String, Object )
- Correlates the elements of two sequences based on matching keys. The default equality comparer is used to compare keys.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable Join (
- this IQueryable outer ,
- IEnumerable inner ,
- string outerKeySelector ,
- string innerKeySelector ,
- string resultSelector ,
- params Object [] args
-)Parameters outer Type: System.Linq IQueryable The first sequence to join. inner Type: System.Collections IEnumerable The sequence to join to the first sequence. outerKeySelector Type: System String A dynamic function to extract the join key from each element of the first sequence. innerKeySelector Type: System String A dynamic function to extract the join key from each element of the second sequence. resultSelector Type: System String A dynamic function to create a result element from two matching elements. args Type: System Object An object array that contains zero or more objects to insert into the predicates as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable An
IQueryable obtained by performing an inner join on two sequences.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/2ee00d35-a249-077d-04f7-6e8d035dcfb2.htm b/docs/html/2ee00d35-a249-077d-04f7-6e8d035dcfb2.htm
deleted file mode 100644
index bd4ad5c4c..000000000
--- a/docs/html/2ee00d35-a249-077d-04f7-6e8d035dcfb2.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicClass.Item Property DynamicClass Item Property
- Gets or sets the
Object with the specified name.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic Object this [
- string name
-] { get ; set ; }Parameters name Type: System String The name. Property Value Type:
Object The
Object .
Return Value Type:
Object Value from the property.
See Also
\ No newline at end of file
diff --git a/docs/html/2ee602f5-69fd-21ac-a1ad-e010a4708da4.htm b/docs/html/2ee602f5-69fd-21ac-a1ad-e010a4708da4.htm
deleted file mode 100644
index a7ef7d111..000000000
--- a/docs/html/2ee602f5-69fd-21ac-a1ad-e010a4708da4.htm
+++ /dev/null
@@ -1,6 +0,0 @@
-
ExtensibilityPoint Fields
\ No newline at end of file
diff --git a/docs/html/2f28da13-3fcd-926c-2fa5-034bbc5cf86d.htm b/docs/html/2f28da13-3fcd-926c-2fa5-034bbc5cf86d.htm
deleted file mode 100644
index 3fd95e8c3..000000000
--- a/docs/html/2f28da13-3fcd-926c-2fa5-034bbc5cf86d.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicProperty Constructor DynamicProperty Constructor
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic DynamicProperty (
- string name ,
- Type type
-)Parameters name Type: System String The name from the property. type Type: System Type The type from the property. See Also
\ No newline at end of file
diff --git a/docs/html/2f911e16-18a7-ecff-6389-eb8194b44bd2.htm b/docs/html/2f911e16-18a7-ecff-6389-eb8194b44bd2.htm
deleted file mode 100644
index f8dabbc6c..000000000
--- a/docs/html/2f911e16-18a7-ecff-6389-eb8194b44bd2.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.FirstOrDefault Method (IQueryable, LambdaExpression) DynamicQueryableExtensions FirstOrDefault Method (IQueryable, LambdaExpression)
- Returns the first element of a sequence that satisfies a specified condition or a default value if no such element is found.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/2fa0d1d9-0b97-9906-71ef-4cb3b3ed94ee.htm b/docs/html/2fa0d1d9-0b97-9906-71ef-4cb3b3ed94ee.htm
deleted file mode 100644
index b5a729634..000000000
--- a/docs/html/2fa0d1d9-0b97-9906-71ef-4cb3b3ed94ee.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicQueryableExtensions.Single Method (IQueryable, String, Object[]) DynamicQueryableExtensions Single Method (IQueryable, String, Object )
- Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there
- is not exactly one element in the sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static Object Single (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable The IQueryable to return the last element of. predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Object The first element in source that passes the test in predicate.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/309b3000-751d-31ec-f12d-31ceade60ecf.htm b/docs/html/309b3000-751d-31ec-f12d-31ceade60ecf.htm
deleted file mode 100644
index 9ec343b00..000000000
--- a/docs/html/309b3000-751d-31ec-f12d-31ceade60ecf.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DefaultDynamicLinqCustomTypeProvider Constructor DefaultDynamicLinqCustomTypeProvider Constructor
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic DefaultDynamicLinqCustomTypeProvider (
- bool cacheCustomTypes = true
-)Parameters cacheCustomTypes (Optional)Type: System Boolean Defines whether to cache the CustomTypes which are found in the Application Domain. Default set to 'true'. See Also
\ No newline at end of file
diff --git a/docs/html/31718d6a-79f0-044f-6dbf-ede23f2061af.htm b/docs/html/31718d6a-79f0-044f-6dbf-ede23f2061af.htm
deleted file mode 100644
index 9f83f03fb..000000000
--- a/docs/html/31718d6a-79f0-044f-6dbf-ede23f2061af.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
ParsingConfig.AllowNewToEvaluateAnyType Property ParsingConfig AllowNewToEvaluateAnyType Property
- Allows the New() keyword to evaluate any available Type. Default value is false.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic bool AllowNewToEvaluateAnyType { get ; set ; }Property Value Type:
Boolean See Also
\ No newline at end of file
diff --git a/docs/html/3341bd53-2b91-10a4-7f2a-2af379592611.htm b/docs/html/3341bd53-2b91-10a4-7f2a-2af379592611.htm
deleted file mode 100644
index 04258b749..000000000
--- a/docs/html/3341bd53-2b91-10a4-7f2a-2af379592611.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.Where(TSource) Method (Void, TSource, IQueryable, Void) DynamicQueryableExtensions WhereTSource Method (Void, TSource , IQueryable, Void)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Where``1(System.Void,``0,System.Linq.IQueryable`1,System.Void)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable Where <TSource>(
- this void source ,
- TSource config ,
- IQueryable predicate ,
- params void args
-)
-Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Where``1(System.Void,``0,System.Linq.IQueryable`1,System.Void)"]
config Type: TSource [Missing <param name="config"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Where``1(System.Void,``0,System.Linq.IQueryable`1,System.Void)"]
predicate Type: System.Linq IQueryable T [Missing <param name="predicate"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Where``1(System.Void,``0,System.Linq.IQueryable`1,System.Void)"]
args Type: System Void [Missing <param name="args"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Where``1(System.Void,``0,System.Linq.IQueryable`1,System.Void)"]
Type Parameters TSource [Missing <typeparam name="TSource"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Where``1(System.Void,``0,System.Linq.IQueryable`1,System.Void)"]
Return Value Type:
IQueryable T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Where``1(System.Void,``0,System.Linq.IQueryable`1,System.Void)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/338e1130-f4c3-67b5-3977-34f5c2813f12.htm b/docs/html/338e1130-f4c3-67b5-3977-34f5c2813f12.htm
deleted file mode 100644
index 246464e08..000000000
--- a/docs/html/338e1130-f4c3-67b5-3977-34f5c2813f12.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
ExpressionParser Methods The ExpressionParser type exposes the following members.
Methods
-
- Name Description Equals Determines whether the specified object is equal to the current object.
(Inherited from Object .)Finalize Allows an object to try to free resources and perform other cleanup operations before it is reclaimed by garbage collection.
(Inherited from Object .)GetHashCode Serves as the default hash function.
(Inherited from Object .)GetType Gets the
Type of the current instance.
(Inherited from Object .)MemberwiseClone Creates a shallow copy of the current
Object .
(Inherited from Object .)Parse
- Uses the TextParser to parse the string into the specified result type.
-
ToString Returns a string that represents the current object.
(Inherited from Object .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/33b0c784-9ef9-7af8-a4e4-195794ecddd1.htm b/docs/html/33b0c784-9ef9-7af8-a4e4-195794ecddd1.htm
deleted file mode 100644
index 1b3ed32d9..000000000
--- a/docs/html/33b0c784-9ef9-7af8-a4e4-195794ecddd1.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicQueryableExtensions.GroupByMany(TElement) Method (IEnumerable(TElement), ParsingConfig, String[]) DynamicQueryableExtensions GroupByManyTElement Method (IEnumerableTElement , ParsingConfig, String )
- Groups the elements of a sequence according to multiple specified key string functions
- and creates a result value from each group (and subgroups) and its key.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/3452b730-de6d-986a-914f-14a0eab97dd8.htm b/docs/html/3452b730-de6d-986a-914f-14a0eab97dd8.htm
deleted file mode 100644
index c671a913a..000000000
--- a/docs/html/3452b730-de6d-986a-914f-14a0eab97dd8.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.SingleOrDefaultAsync Method (IQueryable, CancellationToken) EntityFrameworkDynamicQueryableExtensions SingleOrDefaultAsync Method (IQueryable, CancellationToken)
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntax Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/3508fc53-16f9-f409-6784-2572b063b281.htm b/docs/html/3508fc53-16f9-f409-6784-2572b063b281.htm
deleted file mode 100644
index 54b5142ca..000000000
--- a/docs/html/3508fc53-16f9-f409-6784-2572b063b281.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
ParseException.GetObjectData Method ParseException GetObjectData Method
- When overridden in a derived class, sets the
SerializationInfo with information about the exception.
-
-
Namespace:
-
System.Linq.Dynamic.Core.Exceptions
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/356f7e9e-a480-6e2d-df6c-ee2fab1fd24b.htm b/docs/html/356f7e9e-a480-6e2d-df6c-ee2fab1fd24b.htm
deleted file mode 100644
index 192376ab8..000000000
--- a/docs/html/356f7e9e-a480-6e2d-df6c-ee2fab1fd24b.htm
+++ /dev/null
@@ -1,15 +0,0 @@
-
DynamicQueryableExtensions.Any Method (IQueryable, ParsingConfig, String, Object[]) DynamicQueryableExtensions Any Method (IQueryable, ParsingConfig, String, Object )
- Determines whether a sequence contains any elements.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax ExamplesIQueryable queryable = employees.AsQueryable();
-var result1 = queryable.Any("Income > 50" );
-var result2 = queryable.Any("Income > @0" , 50 );
-var result3 = queryable.Select("Roles.Any()" ); See Also
\ No newline at end of file
diff --git a/docs/html/369e6aa6-f96f-f4dd-06f2-7560309f8ca1.htm b/docs/html/369e6aa6-f96f-f4dd-06f2-7560309f8ca1.htm
deleted file mode 100644
index 149a17723..000000000
--- a/docs/html/369e6aa6-f96f-f4dd-06f2-7560309f8ca1.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.AnyAsync Method EntityFrameworkDynamicQueryableExtensions AnyAsync Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/37641f28-2b4c-1a90-e253-15e87d91dd47.htm b/docs/html/37641f28-2b4c-1a90-e253-15e87d91dd47.htm
deleted file mode 100644
index e39c7b515..000000000
--- a/docs/html/37641f28-2b4c-1a90-e253-15e87d91dd47.htm
+++ /dev/null
@@ -1,14 +0,0 @@
-
DynamicExpressionParser.ParseLambda Method (ParsingConfig, Boolean, ParameterExpression[], Type, String, Object[])
DynamicExpressionParser ParseLambda Method (ParsingConfig, Boolean, ParameterExpression , Type, String, Object )
- Parses an expression into a LambdaExpression.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static LambdaExpression ParseLambda (
- ParsingConfig parsingConfig ,
- bool createParameterCtor ,
- ParameterExpression [] parameters ,
- Type resultType ,
- string expression ,
- params Object [] values
-)Parameters parsingConfig Type: System.Linq.Dynamic.Core ParsingConfig The Configuration for the parsing. createParameterCtor Type: System Boolean if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. parameters Type: System.Linq.Expressions ParameterExpression A array from ParameterExpressions. resultType Type: System Type Type of the result. If not specified, it will be generated dynamically. expression Type: System String The expression. values Type: System Object An object array that contains zero or more objects which are used as replacement values. Return Value Type:
LambdaExpression The generated
LambdaExpression See Also
\ No newline at end of file
diff --git a/docs/html/37f8ecfe-fab1-579a-8d06-1b76d7e2c537.htm b/docs/html/37f8ecfe-fab1-579a-8d06-1b76d7e2c537.htm
deleted file mode 100644
index 89de67568..000000000
--- a/docs/html/37f8ecfe-fab1-579a-8d06-1b76d7e2c537.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.CountAsync Method (IQueryable, String, Object[]) EntityFrameworkDynamicQueryableExtensions CountAsync Method (IQueryable, String, Object )
- Asynchronously returns the number of elements in a sequence that satisfy a condition.
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <int > CountAsync (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable that contains the elements to be counted.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Int32
- A task that represents the asynchronous operation.
- The task result contains the number of elements in the sequence that satisfy the condition in the predicate
- function.
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/38b4c8b7-3d22-8847-e49d-f72c8612b2e5.htm b/docs/html/38b4c8b7-3d22-8847-e49d-f72c8612b2e5.htm
deleted file mode 100644
index d37cc478e..000000000
--- a/docs/html/38b4c8b7-3d22-8847-e49d-f72c8612b2e5.htm
+++ /dev/null
@@ -1,25 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.LastOrDefaultAsync Method (IQueryable, CancellationToken, String, Object[]) EntityFrameworkDynamicQueryableExtensions LastOrDefaultAsync Method (IQueryable, CancellationToken, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition
- or a default value if no such element is found. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > LastOrDefaultAsync (
- this IQueryable source ,
- CancellationToken cancellationToken ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the last element of.
- cancellationToken Type: System.Threading CancellationToken
- A CancellationToken to observe while waiting for the task to complete.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation.
- The task result contains
default if
source
- is empty or if no element passes the test specified by
predicate ; otherwise, the last
- element in
source that passes the test specified by
predicate .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/38c4b637-b07c-3339-19a3-c93c778f64f3.htm b/docs/html/38c4b637-b07c-3339-19a3-c93c778f64f3.htm
deleted file mode 100644
index e7b89814e..000000000
--- a/docs/html/38c4b637-b07c-3339-19a3-c93c778f64f3.htm
+++ /dev/null
@@ -1,52 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions Methods EntityFrameworkDynamicQueryableExtensions Methods
Methods
-
- Name Description AnyAsync(IQueryable, CancellationToken)
- Asynchronously determines whether a sequence contains any elements.
-
AnyAsync(IQueryable, String, Object )
- Asynchronously determines whether any element of a sequence satisfies a condition.
-
AnyAsync(IQueryable, String, CancellationToken, Object )
- Asynchronously determines whether any element of a sequence satisfies a condition.
-
CountAsync(IQueryable, CancellationToken)
- Asynchronously returns the number of elements in a sequence.
-
CountAsync(IQueryable, String, Object )
- Asynchronously returns the number of elements in a sequence that satisfy a condition.
-
CountAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the number of elements in a sequence that satisfy a condition.
-
FirstAsync(IQueryable, CancellationToken)
- Asynchronously returns the first element of a sequence.
-
FirstAsync(IQueryable, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition.
-
FirstAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition.
-
FirstOrDefaultAsync(IQueryable, CancellationToken)
- Asynchronously returns the first element of a sequence, or a default value if the sequence contains no elements.
-
FirstOrDefaultAsync(IQueryable, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition
- or a default value if no such element is found.
-
FirstOrDefaultAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition
- or a default value if no such element is found.
-
LastAsync(IQueryable, CancellationToken)
- Asynchronously returns the last element of a sequence. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastAsync(IQueryable, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastOrDefaultAsync(IQueryable, CancellationToken)
- Asynchronously returns the last element of a sequence, or a default value if the sequence contains no elements. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastOrDefaultAsync(IQueryable, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition
- or a default value if no such element is found. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastOrDefaultAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition
- or a default value if no such element is found. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
SingleOrDefaultAsync(IQueryable, CancellationToken)
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
SingleOrDefaultAsync(IQueryable, String, Object )
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
SingleOrDefaultAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/3944ac97-d70b-410f-89de-bbf48afaf980.htm b/docs/html/3944ac97-d70b-410f-89de-bbf48afaf980.htm
deleted file mode 100644
index b143951cb..000000000
--- a/docs/html/3944ac97-d70b-410f-89de-bbf48afaf980.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
DynamicClass Constructor
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/3a401275-29f1-664f-0c26-e5fe4d4aa322.htm b/docs/html/3a401275-29f1-664f-0c26-e5fe4d4aa322.htm
deleted file mode 100644
index 4a33d742d..000000000
--- a/docs/html/3a401275-29f1-664f-0c26-e5fe4d4aa322.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.SelectMany(TResult) Method (Void, TResult, IQueryable, ParsingConfig) DynamicQueryableExtensions SelectManyTResult Method (Void, TResult , IQueryable, ParsingConfig)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.SelectMany``1(System.Void,``0,System.Linq.IQueryable,System.Linq.Dynamic.Core.ParsingConfig)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable SelectMany <TResult>(
- this void source ,
- TResult config ,
- IQueryable selector ,
- params ParsingConfig args
-)
-Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.SelectMany``1(System.Void,``0,System.Linq.IQueryable,System.Linq.Dynamic.Core.ParsingConfig)"]
config Type: TResult [Missing <param name="config"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.SelectMany``1(System.Void,``0,System.Linq.IQueryable,System.Linq.Dynamic.Core.ParsingConfig)"]
selector Type: System.Linq IQueryable [Missing <param name="selector"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.SelectMany``1(System.Void,``0,System.Linq.IQueryable,System.Linq.Dynamic.Core.ParsingConfig)"]
args Type: System.Linq.Dynamic.Core ParsingConfig [Missing <param name="args"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.SelectMany``1(System.Void,``0,System.Linq.IQueryable,System.Linq.Dynamic.Core.ParsingConfig)"]
Type Parameters TResult [Missing <typeparam name="TResult"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.SelectMany``1(System.Void,``0,System.Linq.IQueryable,System.Linq.Dynamic.Core.ParsingConfig)"]
Return Value Type:
IQueryable T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.SelectMany``1(System.Void,``0,System.Linq.IQueryable,System.Linq.Dynamic.Core.ParsingConfig)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/3acf73c0-5300-6f59-97f6-f0c35e6db695.htm b/docs/html/3acf73c0-5300-6f59-97f6-f0c35e6db695.htm
deleted file mode 100644
index 6a7fe35aa..000000000
--- a/docs/html/3acf73c0-5300-6f59-97f6-f0c35e6db695.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicExpressionParser.ParseLambda Method (Boolean, Type, Type, String, Object[]) DynamicExpressionParser ParseLambda Method (Boolean, Type, Type, String, Object )
- Parses an expression into a LambdaExpression.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static LambdaExpression ParseLambda (
- bool createParameterCtor ,
- Type itType ,
- Type resultType ,
- string expression ,
- params Object [] values
-)Parameters createParameterCtor Type: System Boolean if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. itType Type: System Type The main type from the dynamic class expression. resultType Type: System Type Type of the result. If not specified, it will be generated dynamically. expression Type: System String The expression. values Type: System Object An object array that contains zero or more objects which are used as replacement values. Return Value Type:
LambdaExpression The generated
LambdaExpression See Also
\ No newline at end of file
diff --git a/docs/html/3ad2010d-6efd-39f7-e6bc-30955cb4fbf6.htm b/docs/html/3ad2010d-6efd-39f7-e6bc-30955cb4fbf6.htm
deleted file mode 100644
index 3b83093f1..000000000
--- a/docs/html/3ad2010d-6efd-39f7-e6bc-30955cb4fbf6.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.LastAsync Method (IQueryable, CancellationToken) EntityFrameworkDynamicQueryableExtensions LastAsync Method (IQueryable, CancellationToken)
- Asynchronously returns the last element of a sequence. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntax Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/3bfc4ced-5b36-d1a4-32f6-1d8fe54500b9.htm b/docs/html/3bfc4ced-5b36-d1a4-32f6-1d8fe54500b9.htm
deleted file mode 100644
index 26c3e81d0..000000000
--- a/docs/html/3bfc4ced-5b36-d1a4-32f6-1d8fe54500b9.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.CountAsync Method (IQueryable, CancellationToken) EntityFrameworkDynamicQueryableExtensions CountAsync Method (IQueryable, CancellationToken)
- Asynchronously returns the number of elements in a sequence.
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntax Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/3c0f5b0c-c3a6-cf67-bf11-b7997ecc1d2b.htm b/docs/html/3c0f5b0c-c3a6-cf67-bf11-b7997ecc1d2b.htm
deleted file mode 100644
index 15e4e6b0e..000000000
--- a/docs/html/3c0f5b0c-c3a6-cf67-bf11-b7997ecc1d2b.htm
+++ /dev/null
@@ -1,17 +0,0 @@
-
DynamicClass Methods The DynamicClass type exposes the following members.
Methods See Also
\ No newline at end of file
diff --git a/docs/html/3ccebd50-94d3-b01b-5152-602a96eba478.htm b/docs/html/3ccebd50-94d3-b01b-5152-602a96eba478.htm
deleted file mode 100644
index 192057bb2..000000000
--- a/docs/html/3ccebd50-94d3-b01b-5152-602a96eba478.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
DynamicClass.GetDynamicPropertyValue Method DynamicClass GetDynamicPropertyValue Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/3daf092d-539c-7658-44fd-048a1fb76378.htm b/docs/html/3daf092d-539c-7658-44fd-048a1fb76378.htm
deleted file mode 100644
index 7d45f005f..000000000
--- a/docs/html/3daf092d-539c-7658-44fd-048a1fb76378.htm
+++ /dev/null
@@ -1,25 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.FirstOrDefaultAsync Method (IQueryable, CancellationToken, String, Object[]) EntityFrameworkDynamicQueryableExtensions FirstOrDefaultAsync Method (IQueryable, CancellationToken, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition
- or a default value if no such element is found.
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > FirstOrDefaultAsync (
- this IQueryable source ,
- CancellationToken cancellationToken ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the first element of.
- cancellationToken Type: System.Threading CancellationToken
- A CancellationToken to observe while waiting for the task to complete.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation.
- The task result contains
default if
source
- is empty or if no element passes the test specified by
predicate ; otherwise, the first
- element in
source that passes the test specified by
predicate .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/3ee48aa3-346b-30a0-6fbc-617192647c7e.htm b/docs/html/3ee48aa3-346b-30a0-6fbc-617192647c7e.htm
deleted file mode 100644
index cae985807..000000000
--- a/docs/html/3ee48aa3-346b-30a0-6fbc-617192647c7e.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.Count Method (IQueryable) DynamicQueryableExtensions Count Method (IQueryable)
- Returns the number of elements in a sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax ExamplesIQueryable queryable = employees.AsQueryable();
-var result = queryable.Count(); See Also
\ No newline at end of file
diff --git a/docs/html/3f310d0d-47d1-c5af-63bf-2bb2cd48f9dc.htm b/docs/html/3f310d0d-47d1-c5af-63bf-2bb2cd48f9dc.htm
deleted file mode 100644
index ae7da0a4e..000000000
--- a/docs/html/3f310d0d-47d1-c5af-63bf-2bb2cd48f9dc.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
System.Linq.Dynamic.Core.Exceptions Namespace System.Linq.Dynamic.Core.Exceptions Namespace
All exceptions are defined here
Classes
-
- Class Description ParseException
- Represents errors that occur while parsing dynamic linq string expressions.
-
\ No newline at end of file
diff --git a/docs/html/3f97a6b3-b805-4e5b-d0f0-a10e48ece1ae.htm b/docs/html/3f97a6b3-b805-4e5b-d0f0-a10e48ece1ae.htm
deleted file mode 100644
index b7eb01bba..000000000
--- a/docs/html/3f97a6b3-b805-4e5b-d0f0-a10e48ece1ae.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
DefaultDynamicLinqCustomTypeProvider.ResolveTypeBySimpleName Method DefaultDynamicLinqCustomTypeProvider ResolveTypeBySimpleName Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/439b09bc-d6d7-1575-609a-520a5c650cd9.htm b/docs/html/439b09bc-d6d7-1575-609a-520a5c650cd9.htm
deleted file mode 100644
index 7f0d25476..000000000
--- a/docs/html/439b09bc-d6d7-1575-609a-520a5c650cd9.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicQueryableExtensions.GroupByMany(TElement) Method (IEnumerable(TElement), String[]) DynamicQueryableExtensions GroupByManyTElement Method (IEnumerableTElement , String )
- Groups the elements of a sequence according to multiple specified key string functions
- and creates a result value from each group (and subgroups) and its key.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/454e591d-cdeb-969c-afc1-4d26dfd8ae43.htm b/docs/html/454e591d-cdeb-969c-afc1-4d26dfd8ae43.htm
deleted file mode 100644
index 9347c171e..000000000
--- a/docs/html/454e591d-cdeb-969c-afc1-4d26dfd8ae43.htm
+++ /dev/null
@@ -1,23 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.AnyAsync Method (IQueryable, String, CancellationToken, Object[]) EntityFrameworkDynamicQueryableExtensions AnyAsync Method (IQueryable, String, CancellationToken, Object )
- Asynchronously determines whether any element of a sequence satisfies a condition.
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <bool > AnyAsync (
- this IQueryable source ,
- string predicate ,
- CancellationToken cancellationToken = null ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable whose elements to test for a condition.
- predicate Type: System String A function to test each element for a condition. cancellationToken (Optional)Type: System.Threading CancellationToken
- A CancellationToken to observe while waiting for the task to complete.
- args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Boolean
- A task that represents the asynchronous operation.
- The task result contains
true if any elements in the source sequence pass the test in the specified
- predicate; otherwise,
false .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/4604db99-bf8f-7e67-5c9b-d23c5b8cd3f8.htm b/docs/html/4604db99-bf8f-7e67-5c9b-d23c5b8cd3f8.htm
deleted file mode 100644
index 0a2157e72..000000000
--- a/docs/html/4604db99-bf8f-7e67-5c9b-d23c5b8cd3f8.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
DynamicQueryableExtensions.GroupJoin Method DynamicQueryableExtensions GroupJoin Method
Overload List
-
- Name Description GroupJoin(IQueryable, IEnumerable, String, String, String, Object )
- Correlates the elements of two sequences based on equality of keys and groups the results. The default equality comparer is used to compare keys.
-
GroupJoin(IQueryable, ParsingConfig, IEnumerable, String, String, String, Object )
- Correlates the elements of two sequences based on equality of keys and groups the results. The default equality comparer is used to compare keys.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/4771be47-ef15-eabc-87a7-18df1bc57ee1.htm b/docs/html/4771be47-ef15-eabc-87a7-18df1bc57ee1.htm
deleted file mode 100644
index cd24247eb..000000000
--- a/docs/html/4771be47-ef15-eabc-87a7-18df1bc57ee1.htm
+++ /dev/null
@@ -1,40 +0,0 @@
-
ParsingConfig Properties The ParsingConfig type exposes the following members.
Properties See Also
\ No newline at end of file
diff --git a/docs/html/4786ab5f-40fe-a19d-8d7f-a7d718a59284.htm b/docs/html/4786ab5f-40fe-a19d-8d7f-a7d718a59284.htm
deleted file mode 100644
index dfa2f078b..000000000
--- a/docs/html/4786ab5f-40fe-a19d-8d7f-a7d718a59284.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicQueryableExtensions.SkipWhile Method (IQueryable, String, Object[]) DynamicQueryableExtensions SkipWhile Method (IQueryable, String, Object )
- Bypasses elements in a sequence as long as a specified condition is true and then returns the remaining elements.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable SkipWhile (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable A sequence to check for being empty. predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable An
IQueryable that contains elements from source starting at the first element in the linear series that does not pass the test specified by predicate.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
ExamplesIQueryable queryable = employees.AsQueryable();
-var result1 = queryable.SkipWhile("Income > 50" );
-var result2 = queryable.SkipWhile("Income > @0" , 50 ); See Also
\ No newline at end of file
diff --git a/docs/html/482af584-da29-573b-8137-93234d9d9550.htm b/docs/html/482af584-da29-573b-8137-93234d9d9550.htm
deleted file mode 100644
index 77523a66d..000000000
--- a/docs/html/482af584-da29-573b-8137-93234d9d9550.htm
+++ /dev/null
@@ -1,15 +0,0 @@
-
DynamicQueryableExtensions.Where Method (IQueryable, String, Object[]) DynamicQueryableExtensions Where Method (IQueryable, String, Object )
- Filters a sequence of values based on a predicate.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable Where (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable A IQueryable to filter. predicate Type: System String An expression string to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable A
IQueryable that contains elements from the input sequence that satisfy the condition specified by predicate.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Examplesvar result1 = queryable.Where("NumberProperty = 1" );
-var result2 = queryable.Where("NumberProperty = @0" , 1 );
-var result3 = queryable.Where("StringProperty = null" );
-var result4 = queryable.Where("StringProperty = \"abc\"" );
-var result5 = queryable.Where("StringProperty = @0" , "abc" ); See Also
\ No newline at end of file
diff --git a/docs/html/48ee95cc-367e-f2ee-6a10-d1d51f1d7c38.htm b/docs/html/48ee95cc-367e-f2ee-6a10-d1d51f1d7c38.htm
deleted file mode 100644
index 7c7f0265d..000000000
--- a/docs/html/48ee95cc-367e-f2ee-6a10-d1d51f1d7c38.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
ExtensibilityPoint Constructor ExtensibilityPoint Constructor
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic ExtensibilityPoint () See Also
\ No newline at end of file
diff --git a/docs/html/4b53e119-96c1-e2b9-34be-98c7caf0c437.htm b/docs/html/4b53e119-96c1-e2b9-34be-98c7caf0c437.htm
deleted file mode 100644
index 9a398e37f..000000000
--- a/docs/html/4b53e119-96c1-e2b9-34be-98c7caf0c437.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicClass.SetDynamicPropertyValue(T) Method (String, T) DynamicClass SetDynamicPropertyValueT Method (String, T )
- Sets the dynamic property value by name.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic void SetDynamicPropertyValue <T>(
- string propertyName ,
- T value
-)
-Parameters propertyName Type: System String Name of the property. value Type: T The value. Type Parameters T The type. See Also
\ No newline at end of file
diff --git a/docs/html/4d9b469b-c6a0-f277-b9ad-0d1d28917d8e.htm b/docs/html/4d9b469b-c6a0-f277-b9ad-0d1d28917d8e.htm
deleted file mode 100644
index 67ef7b4e1..000000000
--- a/docs/html/4d9b469b-c6a0-f277-b9ad-0d1d28917d8e.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
ExpressionParser Properties ExpressionParser Properties
The ExpressionParser type exposes the following members.
Properties
-
- Name Description ItName
- Gets name for the `it` field. By default this is set to the KeyWord value "it".
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/4db734f7-42a3-3502-6396-a134ed1dc333.htm b/docs/html/4db734f7-42a3-3502-6396-a134ed1dc333.htm
deleted file mode 100644
index 13d85bfb4..000000000
--- a/docs/html/4db734f7-42a3-3502-6396-a134ed1dc333.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.Page Method (IQueryable, Int32, Int32) DynamicQueryableExtensions Page Method (IQueryable, Int32, Int32)
- Returns the elements as paged.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/4e34232c-cc6d-42fb-a914-cb2b813387f1.htm b/docs/html/4e34232c-cc6d-42fb-a914-cb2b813387f1.htm
deleted file mode 100644
index fe989e2dd..000000000
--- a/docs/html/4e34232c-cc6d-42fb-a914-cb2b813387f1.htm
+++ /dev/null
@@ -1,14 +0,0 @@
-
DynamicQueryableExtensions.GroupJoin Method (IQueryable, IEnumerable, String, String, String, Object[]) DynamicQueryableExtensions GroupJoin Method (IQueryable, IEnumerable, String, String, String, Object )
- Correlates the elements of two sequences based on equality of keys and groups the results. The default equality comparer is used to compare keys.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable GroupJoin (
- this IQueryable outer ,
- IEnumerable inner ,
- string outerKeySelector ,
- string innerKeySelector ,
- string resultSelector ,
- params Object [] args
-)Parameters outer Type: System.Linq IQueryable The first sequence to join. inner Type: System.Collections IEnumerable The sequence to join to the first sequence. outerKeySelector Type: System String A dynamic function to extract the join key from each element of the first sequence. innerKeySelector Type: System String A dynamic function to extract the join key from each element of the second sequence. resultSelector Type: System String A dynamic function to create a result element from an element from the first sequence and a collection of matching elements from the second sequence. args Type: System Object An object array that contains zero or more objects to insert into the predicates as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable An
IQueryable obtained by performing a grouped join on two sequences.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/4e37830c-9940-e285-976a-164ac954c518.htm b/docs/html/4e37830c-9940-e285-976a-164ac954c518.htm
deleted file mode 100644
index 963ffe9eb..000000000
--- a/docs/html/4e37830c-9940-e285-976a-164ac954c518.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicEnumerableAsyncExtensions.ToDynamicArrayAsync(T) Method (IEnumerable) DynamicEnumerableAsyncExtensions ToDynamicArrayAsyncT Method (IEnumerable)
- Async creates an array of dynamic objects from a
IEnumerable .
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/4f3b8d53-8bb0-f985-6d80-9f7dca8fbd73.htm b/docs/html/4f3b8d53-8bb0-f985-6d80-9f7dca8fbd73.htm
deleted file mode 100644
index a285751d2..000000000
--- a/docs/html/4f3b8d53-8bb0-f985-6d80-9f7dca8fbd73.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
DefaultDynamicLinqCustomTypeProvider.GetCustomTypes Method DefaultDynamicLinqCustomTypeProvider GetCustomTypes Method
- Returns a list of custom types that System.Linq.Dynamic.Core will understand.
-
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/4f801c37-c1cf-e3cf-a94f-339d3778e54f.htm b/docs/html/4f801c37-c1cf-e3cf-a94f-339d3778e54f.htm
deleted file mode 100644
index dbdae40a3..000000000
--- a/docs/html/4f801c37-c1cf-e3cf-a94f-339d3778e54f.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
ParseException Properties ParseException Properties
The ParseException type exposes the following members.
Properties
-
- Name Description Data Gets a collection of key/value pairs that provide additional user-defined information about the exception.
(Inherited from Exception .)HelpLink Gets or sets a link to the help file associated with this exception.
(Inherited from Exception .)HResult Gets or sets HRESULT, a coded numerical value that is assigned to a specific exception.
(Inherited from Exception .)InnerException Gets the
Exception instance that caused the current exception.
(Inherited from Exception .)Message Gets a message that describes the current exception.
(Inherited from Exception .)Position
- The location in the parsed string that produced the
ParseException .
-
Source Gets or sets the name of the application or the object that causes the error.
(Inherited from Exception .)StackTrace Gets a string representation of the immediate frames on the call stack.
(Inherited from Exception .)TargetSite Gets the method that throws the current exception.
(Inherited from Exception .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/4fc51792-2e11-7c78-6601-69b6194e7236.htm b/docs/html/4fc51792-2e11-7c78-6601-69b6194e7236.htm
deleted file mode 100644
index 117310775..000000000
--- a/docs/html/4fc51792-2e11-7c78-6601-69b6194e7236.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
DynamicClass.SetDynamicPropertyValue Method DynamicClass SetDynamicPropertyValue Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/4fcb74af-e8be-d74c-c3c0-9ea78251a06b.htm b/docs/html/4fcb74af-e8be-d74c-c3c0-9ea78251a06b.htm
deleted file mode 100644
index 49df74de5..000000000
--- a/docs/html/4fcb74af-e8be-d74c-c3c0-9ea78251a06b.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
IDynamicLinkCustomTypeProvider Methods IDynamicLinkCustomTypeProvider Methods
The IDynamicLinkCustomTypeProvider type exposes the following members.
Methods
-
- Name Description GetCustomTypes
- Returns a list of custom types that System.Linq.Dynamic.Core will understand.
-
ResolveType
- Resolve any type by fullname which is registered in the current application domain.
-
ResolveTypeBySimpleName
- Resolve any type by the simple name which is registered in the current application domain.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/502b87ce-612e-3be3-2f65-ba7e3e6b1b18.htm b/docs/html/502b87ce-612e-3be3-2f65-ba7e3e6b1b18.htm
deleted file mode 100644
index 380915b91..000000000
--- a/docs/html/502b87ce-612e-3be3-2f65-ba7e3e6b1b18.htm
+++ /dev/null
@@ -1,25 +0,0 @@
-
DynamicExpressionParser.ParseLambda Method
DynamicExpressionParser ParseLambda Method
Overload List
-
- Name Description ParseLambda(Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda( ParameterExpression , Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda(Type, Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda TResult (Void, Func TResult , ParsingConfig, Boolean) ParseLambda T, TResult (Void, Func T, TResult , ParsingConfig, Boolean) ParseLambda(ParsingConfig, Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda(Boolean, ParameterExpression , Type, String, Object )
- Parses an expression into a LambdaExpression.
-
ParseLambda(Boolean, Type, Type, String, Object )
- Parses an expression into a LambdaExpression.
-
ParseLambda TResult (Void, Func TResult , ParsingConfig, Boolean, ParameterExpression ) ParseLambda(ParsingConfig, Boolean, Type, String, Object )
- Parses an expression into a LambdaExpression.
-
ParseLambda(ParsingConfig, ParameterExpression , Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda(ParsingConfig, Type, Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda(ParsingConfig, Boolean, ParameterExpression , Type, String, Object )
- Parses an expression into a LambdaExpression.
-
ParseLambda(ParsingConfig, Boolean, Type, Type, String, Object )
- Parses an expression into a LambdaExpression.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/502d0af8-44ef-d218-e918-dfd133663727.htm b/docs/html/502d0af8-44ef-d218-e918-dfd133663727.htm
deleted file mode 100644
index 749aa7e30..000000000
--- a/docs/html/502d0af8-44ef-d218-e918-dfd133663727.htm
+++ /dev/null
@@ -1,19 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.SingleOrDefaultAsync Method (IQueryable, String, Object[]) EntityFrameworkDynamicQueryableExtensions SingleOrDefaultAsync Method (IQueryable, String, Object )
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > SingleOrDefaultAsync (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the single element of.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation. The task result contains the single element of the input sequence that satisfies the condition in
predicate , or default if no such element is found.
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/50bfc0d4-4b1e-8b73-12c9-30a2b76340e0.htm b/docs/html/50bfc0d4-4b1e-8b73-12c9-30a2b76340e0.htm
deleted file mode 100644
index 626429473..000000000
--- a/docs/html/50bfc0d4-4b1e-8b73-12c9-30a2b76340e0.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.Last Method (IQueryable, String, Object[]) DynamicQueryableExtensions Last Method (IQueryable, String, Object )
- Returns the last element of a sequence that satisfies a specified condition.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static Object Last (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable The IQueryable to return the last element of. predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Object The first element in source that passes the test in predicate.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/50e96fe4-c3ee-d8ac-06eb-d57b9728b4ea.htm b/docs/html/50e96fe4-c3ee-d8ac-06eb-d57b9728b4ea.htm
deleted file mode 100644
index a31992d7e..000000000
--- a/docs/html/50e96fe4-c3ee-d8ac-06eb-d57b9728b4ea.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicQueryableExtensions.OfType Method DynamicQueryableExtensions OfType Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/50f9cc5e-8dc9-6fcf-23a6-0a2751295c12.htm b/docs/html/50f9cc5e-8dc9-6fcf-23a6-0a2751295c12.htm
deleted file mode 100644
index 3b2a90840..000000000
--- a/docs/html/50f9cc5e-8dc9-6fcf-23a6-0a2751295c12.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
IAssemblyHelper.GetAssemblies Method IAssemblyHelper GetAssemblies Method
- Gets the assemblies that have been loaded into the execution context of this application domain.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
SyntaxAssembly [] GetAssemblies ()Return Value Type:
Assembly
- An array of assemblies in this application domain.
-
See Also
\ No newline at end of file
diff --git a/docs/html/52258a68-c6cd-eb94-f06c-ff2564b46af9.htm b/docs/html/52258a68-c6cd-eb94-f06c-ff2564b46af9.htm
deleted file mode 100644
index 286286a19..000000000
--- a/docs/html/52258a68-c6cd-eb94-f06c-ff2564b46af9.htm
+++ /dev/null
@@ -1,60 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions Class EntityFrameworkDynamicQueryableExtensions Class
- Provides a set of static Async methods for querying data structures that implement
IQueryable .
- It allows dynamic string based querying. Very handy when, at compile time, you don't know the type of queries that will be generated,
- or when downstream components only return column names to sort and filter by.
-
Inheritance HierarchySystem Object EntityFramework.DynamicLinq EntityFrameworkDynamicQueryableExtensions
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static class EntityFrameworkDynamicQueryableExtensions Methods
-
- Name Description AnyAsync(IQueryable, CancellationToken)
- Asynchronously determines whether a sequence contains any elements.
-
AnyAsync(IQueryable, String, Object )
- Asynchronously determines whether any element of a sequence satisfies a condition.
-
AnyAsync(IQueryable, String, CancellationToken, Object )
- Asynchronously determines whether any element of a sequence satisfies a condition.
-
CountAsync(IQueryable, CancellationToken)
- Asynchronously returns the number of elements in a sequence.
-
CountAsync(IQueryable, String, Object )
- Asynchronously returns the number of elements in a sequence that satisfy a condition.
-
CountAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the number of elements in a sequence that satisfy a condition.
-
FirstAsync(IQueryable, CancellationToken)
- Asynchronously returns the first element of a sequence.
-
FirstAsync(IQueryable, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition.
-
FirstAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition.
-
FirstOrDefaultAsync(IQueryable, CancellationToken)
- Asynchronously returns the first element of a sequence, or a default value if the sequence contains no elements.
-
FirstOrDefaultAsync(IQueryable, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition
- or a default value if no such element is found.
-
FirstOrDefaultAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition
- or a default value if no such element is found.
-
LastAsync(IQueryable, CancellationToken)
- Asynchronously returns the last element of a sequence. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastAsync(IQueryable, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastOrDefaultAsync(IQueryable, CancellationToken)
- Asynchronously returns the last element of a sequence, or a default value if the sequence contains no elements. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastOrDefaultAsync(IQueryable, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition
- or a default value if no such element is found. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastOrDefaultAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition
- or a default value if no such element is found. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
SingleOrDefaultAsync(IQueryable, CancellationToken)
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
SingleOrDefaultAsync(IQueryable, String, Object )
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
SingleOrDefaultAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/5322a78d-cbe3-7e65-f001-78f5dadfe009.htm b/docs/html/5322a78d-cbe3-7e65-f001-78f5dadfe009.htm
deleted file mode 100644
index ba246721e..000000000
--- a/docs/html/5322a78d-cbe3-7e65-f001-78f5dadfe009.htm
+++ /dev/null
@@ -1,23 +0,0 @@
-
GroupResult Class Inheritance Hierarchy
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
SyntaxThe GroupResult type exposes the following members.
Constructors
-
- Name Description GroupResult Initializes a new instance of the GroupResult class
Top Properties
-
- Name Description Count
- The number of resulting elements in the group.
-
Items
- The resulting elements in the group.
-
Key
- The key value of the group.
-
Subgroups
- The resulting subgroups in the group.
-
Top Methods
-
- Name Description Equals Determines whether the specified object is equal to the current object.
(Inherited from Object .)Finalize Allows an object to try to free resources and perform other cleanup operations before it is reclaimed by garbage collection.
(Inherited from Object .)GetHashCode Serves as the default hash function.
(Inherited from Object .)GetType Gets the
Type of the current instance.
(Inherited from Object .)MemberwiseClone Creates a shallow copy of the current
Object .
(Inherited from Object .)ToString
- Returns a
String showing the key of the group and the number of items in the group.
-
(Overrides Object ToString .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/538022bc-a0ba-e89d-99bc-b9a9a313d75d.htm b/docs/html/538022bc-a0ba-e89d-99bc-b9a9a313d75d.htm
deleted file mode 100644
index 2d17a97a5..000000000
--- a/docs/html/538022bc-a0ba-e89d-99bc-b9a9a313d75d.htm
+++ /dev/null
@@ -1,50 +0,0 @@
-
ParsingConfig Class
- Configuration class for System.Linq.Dynamic.Core.
-
Inheritance Hierarchy
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic class ParsingConfig The ParsingConfig type exposes the following members.
Constructors
-
- Name Description ParsingConfig Initializes a new instance of the ParsingConfig class
Top Properties Methods
-
- Name Description Equals Determines whether the specified object is equal to the current object.
(Inherited from Object .)Finalize Allows an object to try to free resources and perform other cleanup operations before it is reclaimed by garbage collection.
(Inherited from Object .)GetHashCode Serves as the default hash function.
(Inherited from Object .)GetType Gets the
Type of the current instance.
(Inherited from Object .)MemberwiseClone Creates a shallow copy of the current
Object .
(Inherited from Object .)ToString Returns a string that represents the current object.
(Inherited from Object .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/5399fd1f-0b55-99e4-de3f-cdb5694be302.htm b/docs/html/5399fd1f-0b55-99e4-de3f-cdb5694be302.htm
deleted file mode 100644
index ce6fd97f4..000000000
--- a/docs/html/5399fd1f-0b55-99e4-de3f-cdb5694be302.htm
+++ /dev/null
@@ -1,8 +0,0 @@
-
ExtensibilityPoint.QueryOptimizer Field ExtensibilityPoint QueryOptimizer Field
- Place to optimize your queries. Example: Add a reference to Nuget package Linq.Expression.Optimizer
- and in your program initializers set Extensibility.QueryOptimizer = ExpressionOptimizer.visit;
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/53c2e70f-f99b-222f-951d-99d38056ec33.htm b/docs/html/53c2e70f-f99b-222f-951d-99d38056ec33.htm
deleted file mode 100644
index 5ba0283ea..000000000
--- a/docs/html/53c2e70f-f99b-222f-951d-99d38056ec33.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
GroupResult Methods The GroupResult type exposes the following members.
Methods
-
- Name Description Equals Determines whether the specified object is equal to the current object.
(Inherited from Object .)Finalize Allows an object to try to free resources and perform other cleanup operations before it is reclaimed by garbage collection.
(Inherited from Object .)GetHashCode Serves as the default hash function.
(Inherited from Object .)GetType Gets the
Type of the current instance.
(Inherited from Object .)MemberwiseClone Creates a shallow copy of the current
Object .
(Inherited from Object .)ToString
- Returns a
String showing the key of the group and the number of items in the group.
-
(Overrides Object ToString .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/53d96749-3c43-cd07-6619-94fb85a7a641.htm b/docs/html/53d96749-3c43-cd07-6619-94fb85a7a641.htm
deleted file mode 100644
index 25aa5d7a9..000000000
--- a/docs/html/53d96749-3c43-cd07-6619-94fb85a7a641.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.SingleOrDefaultAsync Method EntityFrameworkDynamicQueryableExtensions SingleOrDefaultAsync Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/55a6c83e-c581-8ac9-f803-434224d5fbc6.htm b/docs/html/55a6c83e-c581-8ac9-f803-434224d5fbc6.htm
deleted file mode 100644
index f3b70daf8..000000000
--- a/docs/html/55a6c83e-c581-8ac9-f803-434224d5fbc6.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicQueryableExtensions.GroupByMany Method DynamicQueryableExtensions GroupByMany Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/57882284-95fe-0180-a958-63450b1814ac.htm b/docs/html/57882284-95fe-0180-a958-63450b1814ac.htm
deleted file mode 100644
index 373c69aba..000000000
--- a/docs/html/57882284-95fe-0180-a958-63450b1814ac.htm
+++ /dev/null
@@ -1,14 +0,0 @@
-
DynamicQueryableExtensions.GroupBy Method (IQueryable, String, String, Object[]) DynamicQueryableExtensions GroupBy Method (IQueryable, String, String, Object )
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable GroupBy (
- this IQueryable source ,
- string keySelector ,
- string resultSelector ,
- Object [] args
-)Parameters source Type: System.Linq IQueryable A IQueryable whose elements to group. keySelector Type: System String A string expression to specify the key for each element. resultSelector Type: System String A string expression to specify a result value from each group. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable A
IQueryable where each element represents a projection over a group and its key.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Examplesvar groupResult1 = queryable.GroupBy("NumberPropertyAsKey" , "StringProperty" );
-var groupResult2 = queryable.GroupBy("new (NumberPropertyAsKey, StringPropertyAsKey)" , "new (StringProperty1, StringProperty2)" ); See Also
\ No newline at end of file
diff --git a/docs/html/581b1f5b-6cd3-99b2-f883-4863377c3d48.htm b/docs/html/581b1f5b-6cd3-99b2-f883-4863377c3d48.htm
deleted file mode 100644
index 02256639d..000000000
--- a/docs/html/581b1f5b-6cd3-99b2-f883-4863377c3d48.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
GroupResult.Count Property GroupResult Count Property
- The number of resulting elements in the group.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic int Count { get ; }Property Value Type:
Int32 See Also
\ No newline at end of file
diff --git a/docs/html/58a7de95-1c6b-378b-31e1-88789cce70b0.htm b/docs/html/58a7de95-1c6b-378b-31e1-88789cce70b0.htm
deleted file mode 100644
index ee9d927f5..000000000
--- a/docs/html/58a7de95-1c6b-378b-31e1-88789cce70b0.htm
+++ /dev/null
@@ -1,15 +0,0 @@
-
DynamicEnumerableExtensions Class DynamicEnumerableExtensions Class
Inheritance HierarchySystem Object System.Linq.Dynamic.Core DynamicEnumerableExtensions
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static class DynamicEnumerableExtensions Methods See Also
\ No newline at end of file
diff --git a/docs/html/58c07e13-ecda-5b51-166e-30c41e312af7.htm b/docs/html/58c07e13-ecda-5b51-166e-30c41e312af7.htm
deleted file mode 100644
index 268837c1b..000000000
--- a/docs/html/58c07e13-ecda-5b51-166e-30c41e312af7.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
DynamicQueryableExtensions.Join Method DynamicQueryableExtensions Join Method
Overload List
-
- Name Description Join(IQueryable, IEnumerable, String, String, String, Object )
- Correlates the elements of two sequences based on matching keys. The default equality comparer is used to compare keys.
-
Join TElement (Void, TElement, IQueryable T , Void, TElement, IEnumerable TElement ) Join(IQueryable, ParsingConfig, IEnumerable, String, String, String, Object )
- Correlates the elements of two sequences based on matching keys. The default equality comparer is used to compare keys.
-
Join TElement (Void, TElement, IQueryable T , Void, TElement, ParsingConfig, IEnumerable TElement )
Top See Also
\ No newline at end of file
diff --git a/docs/html/5aba9200-bd4e-f860-8d36-0afe892d923e.htm b/docs/html/5aba9200-bd4e-f860-8d36-0afe892d923e.htm
deleted file mode 100644
index 30b0bdf7d..000000000
--- a/docs/html/5aba9200-bd4e-f860-8d36-0afe892d923e.htm
+++ /dev/null
@@ -1,24 +0,0 @@
-
PagedResult(TSource) Class
- PagedResult{TSource}
-
Inheritance Hierarchy
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic class PagedResult <TSource> : PagedResult
-Type Parameters TSource The type of the source. The PagedResult TSource type exposes the following members.
Constructors Properties Methods
-
- Name Description Equals Determines whether the specified object is equal to the current object.
(Inherited from Object .)Finalize Allows an object to try to free resources and perform other cleanup operations before it is reclaimed by garbage collection.
(Inherited from Object .)GetHashCode Serves as the default hash function.
(Inherited from Object .)GetType Gets the
Type of the current instance.
(Inherited from Object .)MemberwiseClone Creates a shallow copy of the current
Object .
(Inherited from Object .)ToString Returns a string that represents the current object.
(Inherited from Object .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/5abed614-073a-f031-8a3b-e7a9bb4b424a.htm b/docs/html/5abed614-073a-f031-8a3b-e7a9bb4b424a.htm
deleted file mode 100644
index a29dab0cb..000000000
--- a/docs/html/5abed614-073a-f031-8a3b-e7a9bb4b424a.htm
+++ /dev/null
@@ -1,15 +0,0 @@
-
DynamicQueryableExtensions.Single Method DynamicQueryableExtensions Single Method
Overload List
-
- Name Description Single(IQueryable)
- Returns the only element of a sequence, and throws an exception if there
- is not exactly one element in the sequence.
-
Single(IQueryable, LambdaExpression)
- Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there
- is not exactly one element in the sequence.
-
Single(IQueryable, String, Object )
- Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there
- is not exactly one element in the sequence.
-
Single(IQueryable, ParsingConfig, String, Object )
- Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there
- is not exactly one element in the sequence.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/5b8a276a-f777-ebd8-bc2e-fdaae0d40591.htm b/docs/html/5b8a276a-f777-ebd8-bc2e-fdaae0d40591.htm
deleted file mode 100644
index de092f1c1..000000000
--- a/docs/html/5b8a276a-f777-ebd8-bc2e-fdaae0d40591.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.Where(TSource) Method (Void, TSource, IQueryable) DynamicQueryableExtensions WhereTSource Method (Void, TSource , IQueryable)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Where``1(System.Void,``0,System.Linq.IQueryable`1)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable Where <TSource>(
- this void source ,
- TSource predicate ,
- params IQueryable args
-)
-Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Where``1(System.Void,``0,System.Linq.IQueryable`1)"]
predicate Type: TSource [Missing <param name="predicate"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Where``1(System.Void,``0,System.Linq.IQueryable`1)"]
args Type: System.Linq IQueryable T [Missing <param name="args"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Where``1(System.Void,``0,System.Linq.IQueryable`1)"]
Type Parameters TSource [Missing <typeparam name="TSource"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Where``1(System.Void,``0,System.Linq.IQueryable`1)"]
Return Value Type:
IQueryable T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Where``1(System.Void,``0,System.Linq.IQueryable`1)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/5c3cbed3-465e-2b69-3210-344dd57bf7eb.htm b/docs/html/5c3cbed3-465e-2b69-3210-344dd57bf7eb.htm
deleted file mode 100644
index b7a057ef4..000000000
--- a/docs/html/5c3cbed3-465e-2b69-3210-344dd57bf7eb.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
ParsingConfig.Default Property ParsingConfig Default Property
- Default ParsingConfig
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static ParsingConfig Default { get ; }Property Value Type:
ParsingConfig See Also
\ No newline at end of file
diff --git a/docs/html/5cab7506-9a7d-fff2-8dc1-6c37f2b960f8.htm b/docs/html/5cab7506-9a7d-fff2-8dc1-6c37f2b960f8.htm
deleted file mode 100644
index ecce0ebe4..000000000
--- a/docs/html/5cab7506-9a7d-fff2-8dc1-6c37f2b960f8.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.SingleOrDefaultAsync Method (IQueryable, CancellationToken) EntityFrameworkDynamicQueryableExtensions SingleOrDefaultAsync Method (IQueryable, CancellationToken)
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntax Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/5d6f2e38-214a-4945-d160-ca40abda184b.htm b/docs/html/5d6f2e38-214a-4945-d160-ca40abda184b.htm
deleted file mode 100644
index 257304492..000000000
--- a/docs/html/5d6f2e38-214a-4945-d160-ca40abda184b.htm
+++ /dev/null
@@ -1,8 +0,0 @@
-
DynamicEnumerableExtensions.ToDynamicList Method (Void, Object) DynamicEnumerableExtensions ToDynamicList Method (Void, Object)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableExtensions.ToDynamicList(System.Void,System.Object)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static List ToDynamicList (
- this void source ,
- Object type
-)Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableExtensions.ToDynamicList(System.Void,System.Object)"]
type Type: System Object [Missing <param name="type"/> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableExtensions.ToDynamicList(System.Void,System.Object)"]
Return Value Type:
List T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableExtensions.ToDynamicList(System.Void,System.Object)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/5df0a6ee-f8a7-59ba-5ca8-0972aade618b.htm b/docs/html/5df0a6ee-f8a7-59ba-5ca8-0972aade618b.htm
deleted file mode 100644
index 6d841a8e2..000000000
--- a/docs/html/5df0a6ee-f8a7-59ba-5ca8-0972aade618b.htm
+++ /dev/null
@@ -1,52 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions Methods EntityFrameworkDynamicQueryableExtensions Methods
Methods
-
- Name Description AnyAsync(IQueryable, CancellationToken)
- Asynchronously determines whether a sequence contains any elements.
-
AnyAsync(IQueryable, String, Object )
- Asynchronously determines whether any element of a sequence satisfies a condition.
-
AnyAsync(IQueryable, String, CancellationToken, Object )
- Asynchronously determines whether any element of a sequence satisfies a condition.
-
CountAsync(IQueryable, CancellationToken)
- Asynchronously returns the number of elements in a sequence.
-
CountAsync(IQueryable, String, Object )
- Asynchronously returns the number of elements in a sequence that satisfy a condition.
-
CountAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the number of elements in a sequence that satisfy a condition.
-
FirstAsync(IQueryable, CancellationToken)
- Asynchronously returns the first element of a sequence.
-
FirstAsync(IQueryable, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition.
-
FirstAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition.
-
FirstOrDefaultAsync(IQueryable, CancellationToken)
- Asynchronously returns the first element of a sequence, or a default value if the sequence contains no elements.
-
FirstOrDefaultAsync(IQueryable, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition
- or a default value if no such element is found.
-
FirstOrDefaultAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition
- or a default value if no such element is found.
-
LastAsync(IQueryable, CancellationToken)
- Asynchronously returns the last element of a sequence. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastAsync(IQueryable, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastOrDefaultAsync(IQueryable, CancellationToken)
- Asynchronously returns the last element of a sequence, or a default value if the sequence contains no elements. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastOrDefaultAsync(IQueryable, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition
- or a default value if no such element is found. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastOrDefaultAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition
- or a default value if no such element is found. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
SingleOrDefaultAsync(IQueryable, CancellationToken)
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
SingleOrDefaultAsync(IQueryable, String, Object )
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
SingleOrDefaultAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/5e17e33c-4089-d86f-eb0f-c16155d2845f.htm b/docs/html/5e17e33c-4089-d86f-eb0f-c16155d2845f.htm
deleted file mode 100644
index a5ae9a983..000000000
--- a/docs/html/5e17e33c-4089-d86f-eb0f-c16155d2845f.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicClass.TrySetMember Method DynamicClass TrySetMember Method
- Provides the implementation for operations that set member values. Classes derived from the
DynamicObject class can override this method to specify dynamic behavior for operations such as setting a value for a property.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic virtual bool TrySetMember (
- SetMemberBinder binder ,
- Object value
-)Parameters binder Type: System.Dynamic SetMemberBinder Provides information about the object that called the dynamic operation. The binder.Name property provides the name of the member to which the value is being assigned. For example, for the statement sampleObject.SampleProperty = "Test", where sampleObject is an instance of the class derived from the DynamicObject class, binder.Name returns "SampleProperty". The binder.IgnoreCase property specifies whether the member name is case-sensitive. value Type: System Object The value to set to the member. For example, for sampleObject.SampleProperty = "Test", where sampleObject is an instance of the class derived from the DynamicObject class, the value is "Test". Return Value Type:
Boolean
- true if the operation is successful; otherwise, false. If this method returns false, the run-time binder of the language determines the behavior. (In most cases, a language-specific run-time exception is thrown.)
-
See Also
\ No newline at end of file
diff --git a/docs/html/5e52270c-d1f9-9085-34eb-82051fff7285.htm b/docs/html/5e52270c-d1f9-9085-34eb-82051fff7285.htm
deleted file mode 100644
index 450911fc4..000000000
--- a/docs/html/5e52270c-d1f9-9085-34eb-82051fff7285.htm
+++ /dev/null
@@ -1,23 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.LastAsync Method (IQueryable, CancellationToken, String, Object[]) EntityFrameworkDynamicQueryableExtensions LastAsync Method (IQueryable, CancellationToken, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > LastAsync (
- this IQueryable source ,
- CancellationToken cancellationToken ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the last element of.
- cancellationToken Type: System.Threading CancellationToken
- A CancellationToken to observe while waiting for the task to complete.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation.
- The task result contains the last element in
source that passes the test in
-
predicate .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/5f830eca-c091-f095-c8c9-761e3ade1352.htm b/docs/html/5f830eca-c091-f095-c8c9-761e3ade1352.htm
deleted file mode 100644
index ee2ac2aa8..000000000
--- a/docs/html/5f830eca-c091-f095-c8c9-761e3ade1352.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicExpressionParser.ParseLambda(TResult) Method (Void, Func(TResult), ParsingConfig, Boolean, ParameterExpression[])
DynamicExpressionParser ParseLambdaTResult Method (Void, FuncTResult , ParsingConfig, Boolean, ParameterExpression )
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``1(System.Void,System.Func{``0},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean,System.Linq.Expressions.ParameterExpression[])"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static Expression ParseLambda <TResult>(
- void parsingConfig ,
- Func <TResult> createParameterCtor ,
- ParsingConfig parameters ,
- bool expression ,
- params ParameterExpression [] values
-)
-Parameters parsingConfig Type: System Void [Missing <param name="parsingConfig"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``1(System.Void,System.Func{``0},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean,System.Linq.Expressions.ParameterExpression[])"]
createParameterCtor Type: System Func TResult [Missing <param name="createParameterCtor"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``1(System.Void,System.Func{``0},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean,System.Linq.Expressions.ParameterExpression[])"]
parameters Type: System.Linq.Dynamic.Core ParsingConfig [Missing <param name="parameters"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``1(System.Void,System.Func{``0},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean,System.Linq.Expressions.ParameterExpression[])"]
expression Type: System Boolean [Missing <param name="expression"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``1(System.Void,System.Func{``0},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean,System.Linq.Expressions.ParameterExpression[])"]
values Type: System.Linq.Expressions ParameterExpression [Missing <param name="values"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``1(System.Void,System.Func{``0},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean,System.Linq.Expressions.ParameterExpression[])"]
Type Parameters TResult [Missing <typeparam name="TResult"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``1(System.Void,System.Func{``0},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean,System.Linq.Expressions.ParameterExpression[])"]
Return Value Type:
Expression TDelegate [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``1(System.Void,System.Func{``0},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean,System.Linq.Expressions.ParameterExpression[])"]
See Also
\ No newline at end of file
diff --git a/docs/html/60cf4e3d-b957-8668-65f6-d6c4150f6480.htm b/docs/html/60cf4e3d-b957-8668-65f6-d6c4150f6480.htm
deleted file mode 100644
index a89db83d7..000000000
--- a/docs/html/60cf4e3d-b957-8668-65f6-d6c4150f6480.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.First Method DynamicQueryableExtensions First Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/60f75a32-d2a6-3473-c73a-ce56c1b18051.htm b/docs/html/60f75a32-d2a6-3473-c73a-ce56c1b18051.htm
deleted file mode 100644
index 7cff9fc90..000000000
--- a/docs/html/60f75a32-d2a6-3473-c73a-ce56c1b18051.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.FirstOrDefaultAsync Method EntityFrameworkDynamicQueryableExtensions FirstOrDefaultAsync Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/61a8cd31-bcc5-a9dc-7d60-20cb67e58ae6.htm b/docs/html/61a8cd31-bcc5-a9dc-7d60-20cb67e58ae6.htm
deleted file mode 100644
index 76137d537..000000000
--- a/docs/html/61a8cd31-bcc5-a9dc-7d60-20cb67e58ae6.htm
+++ /dev/null
@@ -1,15 +0,0 @@
-
DynamicQueryableExtensions.ThenBy Method (IOrderedQueryable, ParsingConfig, String, Object[]) DynamicQueryableExtensions ThenBy Method (IOrderedQueryable, ParsingConfig, String, Object )
- Performs a subsequent ordering of the elements in a sequence in ascending order according to a key.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax Examplesvar result = queryable.OrderBy("LastName" );
-var resultSingle = result.OrderBy("NumberProperty" );
-var resultSingleDescending = result.OrderBy("NumberProperty DESC" );
-var resultMultiple = result.OrderBy("NumberProperty, StringProperty DESC" ); See Also
\ No newline at end of file
diff --git a/docs/html/625b349f-10ed-e15a-a339-63656c4d6ed0.htm b/docs/html/625b349f-10ed-e15a-a339-63656c4d6ed0.htm
deleted file mode 100644
index ca2ed6b33..000000000
--- a/docs/html/625b349f-10ed-e15a-a339-63656c4d6ed0.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
IDynamicLinkCustomTypeProvider.GetCustomTypes Method IDynamicLinkCustomTypeProvider GetCustomTypes Method
- Returns a list of custom types that System.Linq.Dynamic.Core will understand.
-
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/62888e13-2fc9-e3df-0d7e-23455c12f578.htm b/docs/html/62888e13-2fc9-e3df-0d7e-23455c12f578.htm
deleted file mode 100644
index e699bf007..000000000
--- a/docs/html/62888e13-2fc9-e3df-0d7e-23455c12f578.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
ParseException.ToString Method ParseException ToString Method
- Creates and returns a string representation of the current exception.
-
-
Namespace:
-
System.Linq.Dynamic.Core.Exceptions
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic override string ToString ()Return Value Type:
String A string representation of the current exception.
Implements _Exception ToString See Also
\ No newline at end of file
diff --git a/docs/html/634f3950-239e-2e25-9554-cc4f2f5c74ef.htm b/docs/html/634f3950-239e-2e25-9554-cc4f2f5c74ef.htm
deleted file mode 100644
index f7e3dfd7b..000000000
--- a/docs/html/634f3950-239e-2e25-9554-cc4f2f5c74ef.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
IDynamicLinkCustomTypeProvider.ResolveType Method IDynamicLinkCustomTypeProvider ResolveType Method
- Resolve any type by fullname which is registered in the current application domain.
-
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
SyntaxType ResolveType (
- string typeName
-)Parameters typeName Type: System String The typename to resolve. Return Value Type:
Type A resolved
Type or null when not found.
See Also
\ No newline at end of file
diff --git a/docs/html/63aaaf13-715c-7333-d0e3-3dd00935aea8.htm b/docs/html/63aaaf13-715c-7333-d0e3-3dd00935aea8.htm
deleted file mode 100644
index b50f86993..000000000
--- a/docs/html/63aaaf13-715c-7333-d0e3-3dd00935aea8.htm
+++ /dev/null
@@ -1,23 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.FirstAsync Method (IQueryable, CancellationToken, String, Object[]) EntityFrameworkDynamicQueryableExtensions FirstAsync Method (IQueryable, CancellationToken, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition.
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > FirstAsync (
- this IQueryable source ,
- CancellationToken cancellationToken ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the first element of.
- cancellationToken Type: System.Threading CancellationToken
- A CancellationToken to observe while waiting for the task to complete.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation.
- The task result contains the first element in
source that passes the test in
-
predicate .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/644b1d01-9ef6-e0e9-e9ac-db78fc523bd3.htm b/docs/html/644b1d01-9ef6-e0e9-e9ac-db78fc523bd3.htm
deleted file mode 100644
index bc7229f16..000000000
--- a/docs/html/644b1d01-9ef6-e0e9-e9ac-db78fc523bd3.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.AnyAsync Method (IQueryable, String, Object[]) EntityFrameworkDynamicQueryableExtensions AnyAsync Method (IQueryable, String, Object )
- Asynchronously determines whether any element of a sequence satisfies a condition.
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <bool > AnyAsync (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable whose elements to test for a condition.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Boolean
- A task that represents the asynchronous operation.
- The task result contains
true if any elements in the source sequence pass the test in the specified
- predicate; otherwise,
false .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/657799f7-4fc6-c4f4-dd51-1381a708d6b1.htm b/docs/html/657799f7-4fc6-c4f4-dd51-1381a708d6b1.htm
deleted file mode 100644
index f1b1a5172..000000000
--- a/docs/html/657799f7-4fc6-c4f4-dd51-1381a708d6b1.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.CountAsync Method EntityFrameworkDynamicQueryableExtensions CountAsync Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/675c4168-01f8-7297-65b8-5a87a252eeec.htm b/docs/html/675c4168-01f8-7297-65b8-5a87a252eeec.htm
deleted file mode 100644
index 1b5f210fa..000000000
--- a/docs/html/675c4168-01f8-7297-65b8-5a87a252eeec.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.Last Method (IQueryable, LambdaExpression) DynamicQueryableExtensions Last Method (IQueryable, LambdaExpression)
- Returns the last element of a sequence that satisfies a specified condition.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/67829a69-deb4-f55a-359f-7d7d4e816d15.htm b/docs/html/67829a69-deb4-f55a-359f-7d7d4e816d15.htm
deleted file mode 100644
index 2d82dfd42..000000000
--- a/docs/html/67829a69-deb4-f55a-359f-7d7d4e816d15.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
DefaultDynamicLinqCustomTypeProvider.ResolveType Method DefaultDynamicLinqCustomTypeProvider ResolveType Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/67e6b069-db4f-17b2-37c1-4040b8c1a7d3.htm b/docs/html/67e6b069-db4f-17b2-37c1-4040b8c1a7d3.htm
deleted file mode 100644
index 75a3fb2cc..000000000
--- a/docs/html/67e6b069-db4f-17b2-37c1-4040b8c1a7d3.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
ParsingConfig.UseDynamicObjectClassForAnonymousTypes Property ParsingConfig UseDynamicObjectClassForAnonymousTypes Property
- Gets or sets a value indicating whether to use dynamic object class for anonymous types. Default value is false.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic bool UseDynamicObjectClassForAnonymousTypes { get ; set ; }Property Value Type:
Boolean See Also
\ No newline at end of file
diff --git a/docs/html/685b13e4-b7fc-3911-5146-f804d01dbe30.htm b/docs/html/685b13e4-b7fc-3911-5146-f804d01dbe30.htm
deleted file mode 100644
index bb86fa5d6..000000000
--- a/docs/html/685b13e4-b7fc-3911-5146-f804d01dbe30.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.Count Method (IQueryable, LambdaExpression) DynamicQueryableExtensions Count Method (IQueryable, LambdaExpression)
- Returns the number of elements in a sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/68df6dc2-9655-b3b2-efce-3d3ca2265965.htm b/docs/html/68df6dc2-9655-b3b2-efce-3d3ca2265965.htm
deleted file mode 100644
index 9de9b935b..000000000
--- a/docs/html/68df6dc2-9655-b3b2-efce-3d3ca2265965.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
PagedResult.RowCount Property PagedResult RowCount Property
- Gets or sets the row count.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic int RowCount { get ; set ; }Property Value Type:
Int32
- The row count.
-
See Also
\ No newline at end of file
diff --git a/docs/html/69228784-5dff-d9e3-bcdf-3064d1e7e027.htm b/docs/html/69228784-5dff-d9e3-bcdf-3064d1e7e027.htm
deleted file mode 100644
index 3cd4b427a..000000000
--- a/docs/html/69228784-5dff-d9e3-bcdf-3064d1e7e027.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicQueryableExtensions.SelectMany Method (IQueryable, Type, String, Object[]) DynamicQueryableExtensions SelectMany Method (IQueryable, Type, String, Object )
- Projects each element of a sequence to an
IQueryable and combines the resulting sequences into one sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable SelectMany (
- this IQueryable source ,
- Type resultType ,
- string selector ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable A sequence of values to project. resultType Type: System Type The result type. selector Type: System String A projection string expression to apply to each element. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable An
IQueryable whose elements are the result of invoking a one-to-many projection function on each element of the input sequence.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Examplesvar permissions = users.SelectMany(typeof (Permission), "Roles.SelectMany(Permissions)" ); See Also
\ No newline at end of file
diff --git a/docs/html/6b9e99a7-18b8-480f-a84e-bdef5ff5e8dd.htm b/docs/html/6b9e99a7-18b8-480f-a84e-bdef5ff5e8dd.htm
deleted file mode 100644
index e68addbd9..000000000
--- a/docs/html/6b9e99a7-18b8-480f-a84e-bdef5ff5e8dd.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicQueryableExtensions.Cast Method DynamicQueryableExtensions Cast Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/6ce00864-df23-80ac-8d41-76c6c94319ed.htm b/docs/html/6ce00864-df23-80ac-8d41-76c6c94319ed.htm
deleted file mode 100644
index 44bc45d75..000000000
--- a/docs/html/6ce00864-df23-80ac-8d41-76c6c94319ed.htm
+++ /dev/null
@@ -1,3 +0,0 @@
-
DynamicProperty Methods The DynamicProperty type exposes the following members.
Methods
-
- Name Description Equals Determines whether the specified object is equal to the current object.
(Inherited from Object .)Finalize Allows an object to try to free resources and perform other cleanup operations before it is reclaimed by garbage collection.
(Inherited from Object .)GetHashCode Serves as the default hash function.
(Inherited from Object .)GetType Gets the
Type of the current instance.
(Inherited from Object .)MemberwiseClone Creates a shallow copy of the current
Object .
(Inherited from Object .)ToString Returns a string that represents the current object.
(Inherited from Object .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/6e0a75d1-4793-5db1-466d-e0917e7da1be.htm b/docs/html/6e0a75d1-4793-5db1-466d-e0917e7da1be.htm
deleted file mode 100644
index a79bf4f5a..000000000
--- a/docs/html/6e0a75d1-4793-5db1-466d-e0917e7da1be.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
ExpressionParser.ItName Property ExpressionParser ItName Property
- Gets name for the `it` field. By default this is set to the KeyWord value "it".
-
-
Namespace:
-
System.Linq.Dynamic.Core.Parser
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic string ItName { get ; }Property Value Type:
String See Also
\ No newline at end of file
diff --git a/docs/html/6e6dc88f-a0fa-eb1e-69f2-e5a3dcbcd684.htm b/docs/html/6e6dc88f-a0fa-eb1e-69f2-e5a3dcbcd684.htm
deleted file mode 100644
index d1df8e2f8..000000000
--- a/docs/html/6e6dc88f-a0fa-eb1e-69f2-e5a3dcbcd684.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
AbstractDynamicLinqCustomTypeProvider.GetAssemblyTypesWithDynamicLinqTypeAttribute Method AbstractDynamicLinqCustomTypeProvider GetAssemblyTypesWithDynamicLinqTypeAttribute Method
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/6e6f50a9-368d-0559-c8ec-48139bbdbcbc.htm b/docs/html/6e6f50a9-368d-0559-c8ec-48139bbdbcbc.htm
deleted file mode 100644
index 7df32fa76..000000000
--- a/docs/html/6e6f50a9-368d-0559-c8ec-48139bbdbcbc.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
ParsingConfig.ResolveTypesBySimpleName Property ParsingConfig ResolveTypesBySimpleName Property
- By default finding types by a simple name is not suported.
- Use this flag to use the CustomTypeProvider to resolve types by a simple name like "Employee" instead of "MyDatabase.Entities.Employee".
- Note that a first matching type is returned and this functionality needs to scan all types from all assemblies, so use with caution.
- Default value is false.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic bool ResolveTypesBySimpleName { get ; set ; }Property Value Type:
Boolean See Also
\ No newline at end of file
diff --git a/docs/html/6edcd149-bf11-b2c0-7675-623978830762.htm b/docs/html/6edcd149-bf11-b2c0-7675-623978830762.htm
deleted file mode 100644
index 950d83357..000000000
--- a/docs/html/6edcd149-bf11-b2c0-7675-623978830762.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
PagedResult Constructor
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/70851e62-d7c1-8d85-5dea-6cb130c11452.htm b/docs/html/70851e62-d7c1-8d85-5dea-6cb130c11452.htm
deleted file mode 100644
index 9cb63cea8..000000000
--- a/docs/html/70851e62-d7c1-8d85-5dea-6cb130c11452.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.SelectMany(TResult) Method (Void, TResult, IQueryable) DynamicQueryableExtensions SelectManyTResult Method (Void, TResult , IQueryable)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.SelectMany``1(System.Void,``0,System.Linq.IQueryable)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable SelectMany <TResult>(
- this void source ,
- TResult selector ,
- params IQueryable args
-)
-Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.SelectMany``1(System.Void,``0,System.Linq.IQueryable)"]
selector Type: TResult [Missing <param name="selector"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.SelectMany``1(System.Void,``0,System.Linq.IQueryable)"]
args Type: System.Linq IQueryable [Missing <param name="args"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.SelectMany``1(System.Void,``0,System.Linq.IQueryable)"]
Type Parameters TResult [Missing <typeparam name="TResult"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.SelectMany``1(System.Void,``0,System.Linq.IQueryable)"]
Return Value Type:
IQueryable T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.SelectMany``1(System.Void,``0,System.Linq.IQueryable)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/70888c8c-cd18-0b35-48c1-2b02ec97be69.htm b/docs/html/70888c8c-cd18-0b35-48c1-2b02ec97be69.htm
deleted file mode 100644
index 80f970c24..000000000
--- a/docs/html/70888c8c-cd18-0b35-48c1-2b02ec97be69.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicProperty.Name Property DynamicProperty Name Property
- Gets the name from the property.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic string Name { get ; }Property Value Type:
String
- The name from the property.
-
See Also
\ No newline at end of file
diff --git a/docs/html/7199abad-ffd3-d84e-a9b5-87e29c1da288.htm b/docs/html/7199abad-ffd3-d84e-a9b5-87e29c1da288.htm
deleted file mode 100644
index 7e40fd29d..000000000
--- a/docs/html/7199abad-ffd3-d84e-a9b5-87e29c1da288.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.Any Method DynamicQueryableExtensions Any Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/722f1465-6015-427b-8559-2eb3048e19ae.htm b/docs/html/722f1465-6015-427b-8559-2eb3048e19ae.htm
deleted file mode 100644
index 954c9e23b..000000000
--- a/docs/html/722f1465-6015-427b-8559-2eb3048e19ae.htm
+++ /dev/null
@@ -1,14 +0,0 @@
-
DynamicQueryableExtensions.SkipWhile Method (IQueryable, ParsingConfig, String, Object[]) DynamicQueryableExtensions SkipWhile Method (IQueryable, ParsingConfig, String, Object )
- Bypasses elements in a sequence as long as a specified condition is true and then returns the remaining elements.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable SkipWhile (
- this IQueryable source ,
- ParsingConfig config ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable A sequence to check for being empty. config Type: System.Linq.Dynamic.Core ParsingConfig The ParsingConfig . predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable An
IQueryable that contains elements from source starting at the first element in the linear series that does not pass the test specified by predicate.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
ExamplesIQueryable queryable = employees.AsQueryable();
-var result1 = queryable.SkipWhile("Income > 50" );
-var result2 = queryable.SkipWhile("Income > @0" , 50 ); See Also
\ No newline at end of file
diff --git a/docs/html/724e1f4a-6a2a-ec95-6829-67afcc95acbd.htm b/docs/html/724e1f4a-6a2a-ec95-6829-67afcc95acbd.htm
deleted file mode 100644
index 2d0072505..000000000
--- a/docs/html/724e1f4a-6a2a-ec95-6829-67afcc95acbd.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
GroupResult Constructor
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/72cfe082-7b9b-1c6d-f8ec-c377fb91714d.htm b/docs/html/72cfe082-7b9b-1c6d-f8ec-c377fb91714d.htm
deleted file mode 100644
index f98abba7c..000000000
--- a/docs/html/72cfe082-7b9b-1c6d-f8ec-c377fb91714d.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.Distinct Method DynamicQueryableExtensions Distinct Method
- Returns distinct elements from a sequence by using the default equality comparer to compare values.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax ExamplesIQueryable queryable = employees.AsQueryable();
-var result1 = queryable.Distinct();
-var result2 = queryable.Select("Roles.Distinct()" ); See Also
\ No newline at end of file
diff --git a/docs/html/737e51e1-0b7e-9d1b-fc5f-5bf46603b9f7.htm b/docs/html/737e51e1-0b7e-9d1b-fc5f-5bf46603b9f7.htm
deleted file mode 100644
index 4d6f7f5e6..000000000
--- a/docs/html/737e51e1-0b7e-9d1b-fc5f-5bf46603b9f7.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
IExpressionPromoter.Promote Method IExpressionPromoter Promote Method
- Promote an expression
-
-
Namespace:
-
System.Linq.Dynamic.Core.Parser
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/737f1217-f4a7-2b71-0afe-51f2c079f4ad.htm b/docs/html/737f1217-f4a7-2b71-0afe-51f2c079f4ad.htm
deleted file mode 100644
index 602eb5fdd..000000000
--- a/docs/html/737f1217-f4a7-2b71-0afe-51f2c079f4ad.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
DynamicQueryableExtensions.DefaultIfEmpty Method DynamicQueryableExtensions DefaultIfEmpty Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/74693236-4b0a-c69f-f329-0f841107255e.htm b/docs/html/74693236-4b0a-c69f-f329-0f841107255e.htm
deleted file mode 100644
index 9ca548eed..000000000
--- a/docs/html/74693236-4b0a-c69f-f329-0f841107255e.htm
+++ /dev/null
@@ -1,3 +0,0 @@
-
DynamicLinqTypeAttribute Properties DynamicLinqTypeAttribute Properties
The DynamicLinqTypeAttribute type exposes the following members.
Properties
-
- Name Description TypeId When implemented in a derived class, gets a unique identifier for this
Attribute .
(Inherited from Attribute .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/759a2119-4b7a-6819-4b57-103452d73ce7.htm b/docs/html/759a2119-4b7a-6819-4b57-103452d73ce7.htm
deleted file mode 100644
index 6a23c3e87..000000000
--- a/docs/html/759a2119-4b7a-6819-4b57-103452d73ce7.htm
+++ /dev/null
@@ -1,31 +0,0 @@
-
DynamicQueryableExtensions.SelectMany Method DynamicQueryableExtensions SelectMany Method
Overload List
-
- Name Description SelectMany(IQueryable, String, Object )
- Projects each element of a sequence to an
IQueryable and combines the resulting sequences into one sequence.
-
SelectMany TResult (Void, TResult, IQueryable) SelectMany(IQueryable, ParsingConfig, String, Object )
- Projects each element of a sequence to an
IQueryable and combines the resulting sequences into one sequence.
-
SelectMany(IQueryable, Type, String, Object )
- Projects each element of a sequence to an
IQueryable and combines the resulting sequences into one sequence.
-
SelectMany TResult (Void, TResult, IQueryable, ParsingConfig) SelectMany(IQueryable, ParsingConfig, Type, String, Object )
- Projects each element of a sequence to an
IQueryable and combines the resulting sequences into one sequence.
-
SelectMany(IQueryable, String, String, Object , Object )
- Projects each element of a sequence to an
IQueryable
- and invokes a result selector function on each element therein. The resulting
- values from each intermediate sequence are combined into a single, one-dimensional
- sequence and returned.
-
SelectMany(IQueryable, ParsingConfig, String, String, Object , Object )
- Projects each element of a sequence to an
IQueryable
- and invokes a result selector function on each element therein. The resulting
- values from each intermediate sequence are combined into a single, one-dimensional
- sequence and returned.
-
SelectMany(IQueryable, String, String, String, String, Object , Object )
- Projects each element of a sequence to an
IQueryable
- and invokes a result selector function on each element therein. The resulting
- values from each intermediate sequence are combined into a single, one-dimensional
- sequence and returned.
-
SelectMany(IQueryable, ParsingConfig, String, String, String, String, Object , Object )
- Projects each element of a sequence to an
IQueryable
- and invokes a result selector function on each element therein. The resulting
- values from each intermediate sequence are combined into a single, one-dimensional
- sequence and returned.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/75d0dd76-16d2-c498-6ffb-77a079ae7c96.htm b/docs/html/75d0dd76-16d2-c498-6ffb-77a079ae7c96.htm
deleted file mode 100644
index 8e8f12c62..000000000
--- a/docs/html/75d0dd76-16d2-c498-6ffb-77a079ae7c96.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicQueryableExtensions.SelectMany Method (IQueryable, ParsingConfig, String, Object[]) DynamicQueryableExtensions SelectMany Method (IQueryable, ParsingConfig, String, Object )
- Projects each element of a sequence to an
IQueryable and combines the resulting sequences into one sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax Examplesvar roles = users.SelectMany("Roles" ); See Also
\ No newline at end of file
diff --git a/docs/html/76eaefbe-f902-28bd-e26e-e43142ca1493.htm b/docs/html/76eaefbe-f902-28bd-e26e-e43142ca1493.htm
deleted file mode 100644
index 706b813e1..000000000
--- a/docs/html/76eaefbe-f902-28bd-e26e-e43142ca1493.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
ParsingConfig.CustomTypeProvider Property ParsingConfig CustomTypeProvider Property
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/77c2c620-2401-5409-c20d-f13cc70b8677.htm b/docs/html/77c2c620-2401-5409-c20d-f13cc70b8677.htm
deleted file mode 100644
index a6441ce04..000000000
--- a/docs/html/77c2c620-2401-5409-c20d-f13cc70b8677.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.SingleOrDefault Method (IQueryable, LambdaExpression) DynamicQueryableExtensions SingleOrDefault Method (IQueryable, LambdaExpression)
- Returns the only element of a sequence that satisfies a specified condition or a default value if the sequence
- is empty; and throws an exception if there is not exactly one element in the sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/7aecbfa8-8b16-a50a-29fe-7214fbc5aa63.htm b/docs/html/7aecbfa8-8b16-a50a-29fe-7214fbc5aa63.htm
deleted file mode 100644
index bfe90e004..000000000
--- a/docs/html/7aecbfa8-8b16-a50a-29fe-7214fbc5aa63.htm
+++ /dev/null
@@ -1,17 +0,0 @@
-
DefaultDynamicLinqCustomTypeProvider Methods DefaultDynamicLinqCustomTypeProvider Methods
The DefaultDynamicLinqCustomTypeProvider type exposes the following members.
Methods See Also
\ No newline at end of file
diff --git a/docs/html/7b990b0a-fc6a-828c-6638-8cb36e05d3e8.htm b/docs/html/7b990b0a-fc6a-828c-6638-8cb36e05d3e8.htm
deleted file mode 100644
index 04c0002fd..000000000
--- a/docs/html/7b990b0a-fc6a-828c-6638-8cb36e05d3e8.htm
+++ /dev/null
@@ -1,25 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.LastOrDefaultAsync Method (IQueryable, CancellationToken, String, Object[]) EntityFrameworkDynamicQueryableExtensions LastOrDefaultAsync Method (IQueryable, CancellationToken, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition
- or a default value if no such element is found. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > LastOrDefaultAsync (
- this IQueryable source ,
- CancellationToken cancellationToken ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the last element of.
- cancellationToken Type: System.Threading CancellationToken
- A CancellationToken to observe while waiting for the task to complete.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation.
- The task result contains
default if
source
- is empty or if no element passes the test specified by
predicate ; otherwise, the last
- element in
source that passes the test specified by
predicate .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/7c2ec062-e0e3-b552-4277-9b0711399d1e.htm b/docs/html/7c2ec062-e0e3-b552-4277-9b0711399d1e.htm
deleted file mode 100644
index 9b2f42440..000000000
--- a/docs/html/7c2ec062-e0e3-b552-4277-9b0711399d1e.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicQueryableExtensions.AsEnumerable Method DynamicQueryableExtensions AsEnumerable Method
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/7c38607d-2d4d-72c0-8b05-cc87b1289b24.htm b/docs/html/7c38607d-2d4d-72c0-8b05-cc87b1289b24.htm
deleted file mode 100644
index 2b8a05c25..000000000
--- a/docs/html/7c38607d-2d4d-72c0-8b05-cc87b1289b24.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicQueryableExtensions.Single Method (IQueryable, ParsingConfig, String, Object[]) DynamicQueryableExtensions Single Method (IQueryable, ParsingConfig, String, Object )
- Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there
- is not exactly one element in the sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/7cc37a25-17e5-34f7-e023-83576a9f15ff.htm b/docs/html/7cc37a25-17e5-34f7-e023-83576a9f15ff.htm
deleted file mode 100644
index 0db278644..000000000
--- a/docs/html/7cc37a25-17e5-34f7-e023-83576a9f15ff.htm
+++ /dev/null
@@ -1,25 +0,0 @@
-
DynamicExpressionParser Methods DynamicExpressionParser Methods
Methods
-
- Name Description ParseLambda(Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda( ParameterExpression , Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda(Type, Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda(ParsingConfig, Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda(Boolean, ParameterExpression , Type, String, Object )
- Parses an expression into a LambdaExpression.
-
ParseLambda(Boolean, Type, Type, String, Object )
- Parses an expression into a LambdaExpression.
-
ParseLambda(ParsingConfig, Boolean, Type, String, Object )
- Parses an expression into a LambdaExpression.
-
ParseLambda(ParsingConfig, ParameterExpression , Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda(ParsingConfig, Type, Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda(ParsingConfig, Boolean, ParameterExpression , Type, String, Object )
- Parses an expression into a LambdaExpression.
-
ParseLambda(ParsingConfig, Boolean, Type, Type, String, Object )
- Parses an expression into a LambdaExpression.
-
ParseLambda TResult (Void, Func TResult , ParsingConfig, Boolean) ParseLambda TResult (Void, Func TResult , ParsingConfig, Boolean, ParameterExpression ) ParseLambda T, TResult (Void, Func T, TResult , ParsingConfig, Boolean)
Top See Also
\ No newline at end of file
diff --git a/docs/html/7cc7d11d-e286-ba9c-e050-0b074fa6d9cf.htm b/docs/html/7cc7d11d-e286-ba9c-e050-0b074fa6d9cf.htm
deleted file mode 100644
index cdefca10c..000000000
--- a/docs/html/7cc7d11d-e286-ba9c-e050-0b074fa6d9cf.htm
+++ /dev/null
@@ -1,3 +0,0 @@
-
ExtensibilityPoint Methods ExtensibilityPoint Methods
The ExtensibilityPoint type exposes the following members.
Methods
-
- Name Description Equals Determines whether the specified object is equal to the current object.
(Inherited from Object .)Finalize Allows an object to try to free resources and perform other cleanup operations before it is reclaimed by garbage collection.
(Inherited from Object .)GetHashCode Serves as the default hash function.
(Inherited from Object .)GetType Gets the
Type of the current instance.
(Inherited from Object .)MemberwiseClone Creates a shallow copy of the current
Object .
(Inherited from Object .)ToString Returns a string that represents the current object.
(Inherited from Object .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/7cfc606a-d9ef-cafb-e857-9007d67df7b2.htm b/docs/html/7cfc606a-d9ef-cafb-e857-9007d67df7b2.htm
deleted file mode 100644
index e7261dd1f..000000000
--- a/docs/html/7cfc606a-d9ef-cafb-e857-9007d67df7b2.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.LastOrDefault Method (IQueryable, LambdaExpression) DynamicQueryableExtensions LastOrDefault Method (IQueryable, LambdaExpression)
- Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/7d61c2db-d394-9366-0403-a124d6b62d35.htm b/docs/html/7d61c2db-d394-9366-0403-a124d6b62d35.htm
deleted file mode 100644
index 40c86cab9..000000000
--- a/docs/html/7d61c2db-d394-9366-0403-a124d6b62d35.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.LastAsync Method (IQueryable, String, Object[]) EntityFrameworkDynamicQueryableExtensions LastAsync Method (IQueryable, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > LastAsync (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the last element of.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation.
- The task result contains the last element in
source that passes the test in
-
predicate .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/7da3a81b-d09d-dd8f-4084-8a4e9abf6b8d.htm b/docs/html/7da3a81b-d09d-dd8f-4084-8a4e9abf6b8d.htm
deleted file mode 100644
index c17fac532..000000000
--- a/docs/html/7da3a81b-d09d-dd8f-4084-8a4e9abf6b8d.htm
+++ /dev/null
@@ -1,14 +0,0 @@
-
DynamicQueryableExtensions.Count Method (IQueryable, String, Object[]) DynamicQueryableExtensions Count Method (IQueryable, String, Object )
- Returns the number of elements in a sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static int Count (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable The IQueryable that contains the elements to be counted. predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Int32 The number of elements in the specified sequence that satisfies a condition.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
ExamplesIQueryable queryable = employees.AsQueryable();
-var result1 = queryable.Count("Income > 50" );
-var result2 = queryable.Count("Income > @0" , 50 );
-var result3 = queryable.Select("Roles.Count()" ); See Also
\ No newline at end of file
diff --git a/docs/html/7ee1ea23-6e49-9cb0-b08f-9b637860f771.htm b/docs/html/7ee1ea23-6e49-9cb0-b08f-9b637860f771.htm
deleted file mode 100644
index e30a1fd85..000000000
--- a/docs/html/7ee1ea23-6e49-9cb0-b08f-9b637860f771.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.LastAsync Method (IQueryable, String, Object[]) EntityFrameworkDynamicQueryableExtensions LastAsync Method (IQueryable, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > LastAsync (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the last element of.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation.
- The task result contains the last element in
source that passes the test in
-
predicate .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/7f35c3c4-5195-a494-b036-04afaa2225a6.htm b/docs/html/7f35c3c4-5195-a494-b036-04afaa2225a6.htm
deleted file mode 100644
index 094ca5df0..000000000
--- a/docs/html/7f35c3c4-5195-a494-b036-04afaa2225a6.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicEnumerableAsyncExtensions.ToDynamicArrayAsync Method DynamicEnumerableAsyncExtensions ToDynamicArrayAsync Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/81582e5f-6219-ef6d-b46f-dbe6a3d3cd75.htm b/docs/html/81582e5f-6219-ef6d-b46f-dbe6a3d3cd75.htm
deleted file mode 100644
index 1c4837adf..000000000
--- a/docs/html/81582e5f-6219-ef6d-b46f-dbe6a3d3cd75.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicQueryableExtensions.Sum Method DynamicQueryableExtensions Sum Method
- Computes the sum of a sequence of numeric values.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/8207c093-83e3-6d90-796f-1e9a0e6d629d.htm b/docs/html/8207c093-83e3-6d90-796f-1e9a0e6d629d.htm
deleted file mode 100644
index f7ddd6b3d..000000000
--- a/docs/html/8207c093-83e3-6d90-796f-1e9a0e6d629d.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
ParsingConfig.RenameParameterExpression Property ParsingConfig RenameParameterExpression Property
- Renames the (Typed)ParameterExpression empty Name to a the correct supplied name from `it`. Default value is false.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic bool RenameParameterExpression { get ; set ; }Property Value Type:
Boolean See Also
\ No newline at end of file
diff --git a/docs/html/82c756ac-ae74-3b28-29eb-9603454229c7.htm b/docs/html/82c756ac-ae74-3b28-29eb-9603454229c7.htm
deleted file mode 100644
index 93e263509..000000000
--- a/docs/html/82c756ac-ae74-3b28-29eb-9603454229c7.htm
+++ /dev/null
@@ -1,3 +0,0 @@
-
PagedResult(TSource) Methods PagedResultTSource Methods
The PagedResult TSource generic type exposes the following members.
Methods
-
- Name Description Equals Determines whether the specified object is equal to the current object.
(Inherited from Object .)Finalize Allows an object to try to free resources and perform other cleanup operations before it is reclaimed by garbage collection.
(Inherited from Object .)GetHashCode Serves as the default hash function.
(Inherited from Object .)GetType Gets the
Type of the current instance.
(Inherited from Object .)MemberwiseClone Creates a shallow copy of the current
Object .
(Inherited from Object .)ToString Returns a string that represents the current object.
(Inherited from Object .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/82cab2b4-8a2a-f0b1-0b02-004e75f7e79f.htm b/docs/html/82cab2b4-8a2a-f0b1-0b02-004e75f7e79f.htm
deleted file mode 100644
index fdf936ab3..000000000
--- a/docs/html/82cab2b4-8a2a-f0b1-0b02-004e75f7e79f.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicQueryableExtensions.GroupBy Method (IQueryable, String, Object[]) DynamicQueryableExtensions GroupBy Method (IQueryable, String, Object )
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable GroupBy (
- this IQueryable source ,
- string keySelector ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable A IQueryable whose elements to group. keySelector Type: System String A string expression to specify the key for each element. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable A
IQueryable where each element represents a projection over a group and its key.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Examplesvar groupResult1 = queryable.GroupBy("NumberPropertyAsKey" );
-var groupResult2 = queryable.GroupBy("new (NumberPropertyAsKey, StringPropertyAsKey)" ); See Also
\ No newline at end of file
diff --git a/docs/html/844c188b-1abe-ae61-9fed-3bcfa67f1147.htm b/docs/html/844c188b-1abe-ae61-9fed-3bcfa67f1147.htm
deleted file mode 100644
index 94c4efcee..000000000
--- a/docs/html/844c188b-1abe-ae61-9fed-3bcfa67f1147.htm
+++ /dev/null
@@ -1,8 +0,0 @@
-
DynamicClassFactory Methods
\ No newline at end of file
diff --git a/docs/html/84c56248-70cb-4832-22b1-515d88eaffac.htm b/docs/html/84c56248-70cb-4832-22b1-515d88eaffac.htm
deleted file mode 100644
index d6ed22bc7..000000000
--- a/docs/html/84c56248-70cb-4832-22b1-515d88eaffac.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.Cast Method (IQueryable, Type) DynamicQueryableExtensions Cast Method (IQueryable, Type)
- Converts the elements of an
IQueryable to the specified type.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/84f7fe3f-636b-0feb-ff49-aad91a4b7bb8.htm b/docs/html/84f7fe3f-636b-0feb-ff49-aad91a4b7bb8.htm
deleted file mode 100644
index df33083b2..000000000
--- a/docs/html/84f7fe3f-636b-0feb-ff49-aad91a4b7bb8.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.CountAsync Method (IQueryable, String, Object[]) EntityFrameworkDynamicQueryableExtensions CountAsync Method (IQueryable, String, Object )
- Asynchronously returns the number of elements in a sequence that satisfy a condition.
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <int > CountAsync (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable that contains the elements to be counted.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Int32
- A task that represents the asynchronous operation.
- The task result contains the number of elements in the sequence that satisfy the condition in the predicate
- function.
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/858da6b8-f29c-5d90-5b25-e20a7a586c29.htm b/docs/html/858da6b8-f29c-5d90-5b25-e20a7a586c29.htm
deleted file mode 100644
index 66a8482b5..000000000
--- a/docs/html/858da6b8-f29c-5d90-5b25-e20a7a586c29.htm
+++ /dev/null
@@ -1,14 +0,0 @@
-
DynamicQueryableExtensions.Join(TElement) Method (Void, TElement, IQueryable, Void, TElement, ParsingConfig, IEnumerable(TElement)) DynamicQueryableExtensions JoinTElement Method (Void, TElement , IQueryable, Void, TElement , ParsingConfig, IEnumerableTElement )
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Linq.Dynamic.Core.ParsingConfig,System.Collections.Generic.IEnumerable{``0})"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable Join <TElement>(
- this void outer ,
- TElement config ,
- IQueryable inner ,
- void outerKeySelector ,
- TElement innerKeySelector ,
- ParsingConfig resultSelector ,
- params IEnumerable <TElement> args
-)
-Parameters outer Type: System Void [Missing <param name="outer"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Linq.Dynamic.Core.ParsingConfig,System.Collections.Generic.IEnumerable{``0})"]
config Type: TElement [Missing <param name="config"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Linq.Dynamic.Core.ParsingConfig,System.Collections.Generic.IEnumerable{``0})"]
inner Type: System.Linq IQueryable T [Missing <param name="inner"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Linq.Dynamic.Core.ParsingConfig,System.Collections.Generic.IEnumerable{``0})"]
outerKeySelector Type: System Void [Missing <param name="outerKeySelector"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Linq.Dynamic.Core.ParsingConfig,System.Collections.Generic.IEnumerable{``0})"]
innerKeySelector Type: TElement [Missing <param name="innerKeySelector"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Linq.Dynamic.Core.ParsingConfig,System.Collections.Generic.IEnumerable{``0})"]
resultSelector Type: System.Linq.Dynamic.Core ParsingConfig [Missing <param name="resultSelector"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Linq.Dynamic.Core.ParsingConfig,System.Collections.Generic.IEnumerable{``0})"]
args Type: System.Collections.Generic IEnumerable TElement [Missing <param name="args"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Linq.Dynamic.Core.ParsingConfig,System.Collections.Generic.IEnumerable{``0})"]
Type Parameters TElement [Missing <typeparam name="TElement"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Linq.Dynamic.Core.ParsingConfig,System.Collections.Generic.IEnumerable{``0})"]
Return Value Type:
IQueryable T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Linq.Dynamic.Core.ParsingConfig,System.Collections.Generic.IEnumerable{``0})"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/864bd614-3384-4c20-33df-896092842fd8.htm b/docs/html/864bd614-3384-4c20-33df-896092842fd8.htm
deleted file mode 100644
index b6c5e8843..000000000
--- a/docs/html/864bd614-3384-4c20-33df-896092842fd8.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
ParseException Constructor ParseException Constructor
- Initializes a new instance of the
ParseException class with a specified error message and position.
-
-
Namespace:
-
System.Linq.Dynamic.Core.Exceptions
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic ParseException (
- string message ,
- int position
-)Parameters message Type: System String The message that describes the error. position Type: System Int32 The location in the parsed string that produced the ParseException See Also
\ No newline at end of file
diff --git a/docs/html/86eda2ff-d3ff-a82f-8a90-38aabe127953.htm b/docs/html/86eda2ff-d3ff-a82f-8a90-38aabe127953.htm
deleted file mode 100644
index e2e8fba0f..000000000
--- a/docs/html/86eda2ff-d3ff-a82f-8a90-38aabe127953.htm
+++ /dev/null
@@ -1,21 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.LastOrDefaultAsync Method (IQueryable, CancellationToken) EntityFrameworkDynamicQueryableExtensions LastOrDefaultAsync Method (IQueryable, CancellationToken)
- Asynchronously returns the last element of a sequence, or a default value if the sequence contains no elements. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntax Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/897c5927-6102-febf-7b76-c0e9a179886f.htm b/docs/html/897c5927-6102-febf-7b76-c0e9a179886f.htm
deleted file mode 100644
index b7a17cc2a..000000000
--- a/docs/html/897c5927-6102-febf-7b76-c0e9a179886f.htm
+++ /dev/null
@@ -1,31 +0,0 @@
-
DynamicExpressionParser Class DynamicExpressionParser Class
- Helper class to convert an expression into an LambdaExpression
-
Inheritance HierarchySystem Object System.Linq.Dynamic.Core DynamicExpressionParser
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static class DynamicExpressionParser Methods
-
- Name Description ParseLambda(Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda( ParameterExpression , Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda(Type, Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda(ParsingConfig, Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda(Boolean, ParameterExpression , Type, String, Object )
- Parses an expression into a LambdaExpression.
-
ParseLambda(Boolean, Type, Type, String, Object )
- Parses an expression into a LambdaExpression.
-
ParseLambda(ParsingConfig, Boolean, Type, String, Object )
- Parses an expression into a LambdaExpression.
-
ParseLambda(ParsingConfig, ParameterExpression , Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda(ParsingConfig, Type, Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
ParseLambda(ParsingConfig, Boolean, ParameterExpression , Type, String, Object )
- Parses an expression into a LambdaExpression.
-
ParseLambda(ParsingConfig, Boolean, Type, Type, String, Object )
- Parses an expression into a LambdaExpression.
-
ParseLambda TResult (Void, Func TResult , ParsingConfig, Boolean) ParseLambda TResult (Void, Func TResult , ParsingConfig, Boolean, ParameterExpression ) ParseLambda T, TResult (Void, Func T, TResult , ParsingConfig, Boolean)
Top See Also
\ No newline at end of file
diff --git a/docs/html/89c8f7e0-cb19-fa0e-c577-6fe27d3cd67a.htm b/docs/html/89c8f7e0-cb19-fa0e-c577-6fe27d3cd67a.htm
deleted file mode 100644
index ef5a1a9e2..000000000
--- a/docs/html/89c8f7e0-cb19-fa0e-c577-6fe27d3cd67a.htm
+++ /dev/null
@@ -1,8 +0,0 @@
-
DynamicEnumerableExtensions.ToDynamicList(T) Method (Void) DynamicEnumerableExtensions ToDynamicListT Method (Void)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableExtensions.ToDynamicList``1(System.Void)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static List ToDynamicList <T>(
- this void source
-)
-Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableExtensions.ToDynamicList``1(System.Void)"]
Type Parameters T [Missing <typeparam name="T"/> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableExtensions.ToDynamicList``1(System.Void)"]
Return Value Type:
List T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableExtensions.ToDynamicList``1(System.Void)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/8a0191e5-d3df-a99b-f4b2-a995106fd951.htm b/docs/html/8a0191e5-d3df-a99b-f4b2-a995106fd951.htm
deleted file mode 100644
index 9258fffcf..000000000
--- a/docs/html/8a0191e5-d3df-a99b-f4b2-a995106fd951.htm
+++ /dev/null
@@ -1,19 +0,0 @@
-
ExpressionParser Class
- ExpressionParser
-
Inheritance HierarchySystem Object System.Linq.Dynamic.Core.Parser ExpressionParser
-
Namespace:
-
System.Linq.Dynamic.Core.Parser
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic class ExpressionParser The ExpressionParser type exposes the following members.
Constructors
-
- Name Description ExpressionParser
- Initializes a new instance of the ExpressionParser class.
-
Top Properties
-
- Name Description ItName
- Gets name for the `it` field. By default this is set to the KeyWord value "it".
-
Top Methods
-
- Name Description Equals Determines whether the specified object is equal to the current object.
(Inherited from Object .)Finalize Allows an object to try to free resources and perform other cleanup operations before it is reclaimed by garbage collection.
(Inherited from Object .)GetHashCode Serves as the default hash function.
(Inherited from Object .)GetType Gets the
Type of the current instance.
(Inherited from Object .)MemberwiseClone Creates a shallow copy of the current
Object .
(Inherited from Object .)Parse
- Uses the TextParser to parse the string into the specified result type.
-
ToString Returns a string that represents the current object.
(Inherited from Object .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/8aab3dd1-6d5d-0748-73c5-69370e324482.htm b/docs/html/8aab3dd1-6d5d-0748-73c5-69370e324482.htm
deleted file mode 100644
index 6b49009c0..000000000
--- a/docs/html/8aab3dd1-6d5d-0748-73c5-69370e324482.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicQueryableExtensions.SingleOrDefault Method (IQueryable, String, Object[]) DynamicQueryableExtensions SingleOrDefault Method (IQueryable, String, Object )
- Returns the only element of a sequence that satisfies a specified condition or a default value if the sequence
- is empty; and throws an exception if there is not exactly one element in the sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static Object SingleOrDefault (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable The IQueryable to return the last element of. predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Object The first element in source that passes the test in predicate.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/8ae68a72-152c-5428-1973-60844a869bae.htm b/docs/html/8ae68a72-152c-5428-1973-60844a869bae.htm
deleted file mode 100644
index f5e38fe56..000000000
--- a/docs/html/8ae68a72-152c-5428-1973-60844a869bae.htm
+++ /dev/null
@@ -1,14 +0,0 @@
-
DynamicClassFactory Class DynamicClassFactory Class
Inheritance Hierarchy
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static class DynamicClassFactory The DynamicClassFactory type exposes the following members.
Methods
-
- Name Description CreateType
- The CreateType method creates a new data class with a given set of public properties and returns the System.Type object for the newly created class. If a data class with an identical sequence of properties has already been created, the System.Type object for this class is returned.
- Data classes implement private instance variables and read/write property accessors for the specified properties.Data classes also override the Equals and GetHashCode members to implement by-value equality.
- Data classes are created in an in-memory assembly in the current application domain. All data classes inherit from
DynamicClass and are given automatically generated names that should be considered private (the names will be unique within the application domain but not across multiple invocations of the application). Note that once created, a data class stays in memory for the lifetime of the current application domain. There is currently no way to unload a dynamically created data class.
- The dynamic expression parser uses the CreateClass methods to generate classes from data object initializers. This feature in turn is often used with the dynamic Select method to create projections.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/8b4a66b3-acb2-e86d-daa2-b07d8cbb4ea1.htm b/docs/html/8b4a66b3-acb2-e86d-daa2-b07d8cbb4ea1.htm
deleted file mode 100644
index 148e1edca..000000000
--- a/docs/html/8b4a66b3-acb2-e86d-daa2-b07d8cbb4ea1.htm
+++ /dev/null
@@ -1,16 +0,0 @@
-
DynamicQueryableExtensions.Where Method (IQueryable, ParsingConfig, String, Object[]) DynamicQueryableExtensions Where Method (IQueryable, ParsingConfig, String, Object )
- Filters a sequence of values based on a predicate.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax Examplesvar result1 = queryable.Where("NumberProperty = 1" );
-var result2 = queryable.Where("NumberProperty = @0" , 1 );
-var result3 = queryable.Where("StringProperty = null" );
-var result4 = queryable.Where("StringProperty = \"abc\"" );
-var result5 = queryable.Where("StringProperty = @0" , "abc" ); See Also
\ No newline at end of file
diff --git a/docs/html/8c56b84d-b783-244e-c083-8845b4b523cb.htm b/docs/html/8c56b84d-b783-244e-c083-8845b4b523cb.htm
deleted file mode 100644
index 47e4b2b6f..000000000
--- a/docs/html/8c56b84d-b783-244e-c083-8845b4b523cb.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.ThenBy(TSource) Method (Void, TSource, IOrderedQueryable, Void) DynamicQueryableExtensions ThenByTSource Method (Void, TSource , IOrderedQueryable, Void)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.ThenBy``1(System.Void,``0,System.Linq.IOrderedQueryable`1,System.Void)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IOrderedQueryable ThenBy <TSource>(
- this void source ,
- TSource config ,
- IOrderedQueryable ordering ,
- params void args
-)
-Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.ThenBy``1(System.Void,``0,System.Linq.IOrderedQueryable`1,System.Void)"]
config Type: TSource [Missing <param name="config"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.ThenBy``1(System.Void,``0,System.Linq.IOrderedQueryable`1,System.Void)"]
ordering Type: System.Linq IOrderedQueryable T [Missing <param name="ordering"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.ThenBy``1(System.Void,``0,System.Linq.IOrderedQueryable`1,System.Void)"]
args Type: System Void [Missing <param name="args"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.ThenBy``1(System.Void,``0,System.Linq.IOrderedQueryable`1,System.Void)"]
Type Parameters TSource [Missing <typeparam name="TSource"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.ThenBy``1(System.Void,``0,System.Linq.IOrderedQueryable`1,System.Void)"]
Return Value Type:
IOrderedQueryable T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.ThenBy``1(System.Void,``0,System.Linq.IOrderedQueryable`1,System.Void)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/8c6db65a-0c75-1a36-f23f-4d0e58deef00.htm b/docs/html/8c6db65a-0c75-1a36-f23f-4d0e58deef00.htm
deleted file mode 100644
index ef88aaae7..000000000
--- a/docs/html/8c6db65a-0c75-1a36-f23f-4d0e58deef00.htm
+++ /dev/null
@@ -1,3 +0,0 @@
-
DynamicEnumerableExtensions.ToDynamicList Method DynamicEnumerableExtensions ToDynamicList Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/8c9e6389-18cd-6269-6181-8b148678cfa9.htm b/docs/html/8c9e6389-18cd-6269-6181-8b148678cfa9.htm
deleted file mode 100644
index c3b2e7244..000000000
--- a/docs/html/8c9e6389-18cd-6269-6181-8b148678cfa9.htm
+++ /dev/null
@@ -1,34 +0,0 @@
-
DefaultDynamicLinqCustomTypeProvider Class DefaultDynamicLinqCustomTypeProvider Class
- The default implementation for
IDynamicLinkCustomTypeProvider .
-
- Scans the current AppDomain for all types marked with
DynamicLinqTypeAttribute , and adds them as custom Dynamic Link types.
-
- Also provides functionality to resolve a Type in the current Application Domain.
-
- This class is used as default for full .NET Framework, so not for .NET Core
-
Inheritance Hierarchy
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic class DefaultDynamicLinqCustomTypeProvider : AbstractDynamicLinqCustomTypeProvider ,
- IDynamicLinkCustomTypeProvider The DefaultDynamicLinqCustomTypeProvider type exposes the following members.
Constructors Methods See Also
\ No newline at end of file
diff --git a/docs/html/8ca28150-10d6-2780-268c-d180f0cb7b7e.htm b/docs/html/8ca28150-10d6-2780-268c-d180f0cb7b7e.htm
deleted file mode 100644
index b86e9c677..000000000
--- a/docs/html/8ca28150-10d6-2780-268c-d180f0cb7b7e.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.LastOrDefault Method (IQueryable, String, Object[]) DynamicQueryableExtensions LastOrDefault Method (IQueryable, String, Object )
- Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static Object LastOrDefault (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable The IQueryable to return the last element of. predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Object The first element in source that passes the test in predicate.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/8d5eb1b0-1ad8-5617-e4e0-519da559cf82.htm b/docs/html/8d5eb1b0-1ad8-5617-e4e0-519da559cf82.htm
deleted file mode 100644
index da070e2d2..000000000
--- a/docs/html/8d5eb1b0-1ad8-5617-e4e0-519da559cf82.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.FirstAsync Method EntityFrameworkDynamicQueryableExtensions FirstAsync Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/8d73972a-7c0f-675f-b7b5-d3ec03b3a65a.htm b/docs/html/8d73972a-7c0f-675f-b7b5-d3ec03b3a65a.htm
deleted file mode 100644
index 052cdfc91..000000000
--- a/docs/html/8d73972a-7c0f-675f-b7b5-d3ec03b3a65a.htm
+++ /dev/null
@@ -1,21 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.LastOrDefaultAsync Method (IQueryable, CancellationToken) EntityFrameworkDynamicQueryableExtensions LastOrDefaultAsync Method (IQueryable, CancellationToken)
- Asynchronously returns the last element of a sequence, or a default value if the sequence contains no elements. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntax Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/8dd2dd01-f5ac-818b-e76b-1c2209e63823.htm b/docs/html/8dd2dd01-f5ac-818b-e76b-1c2209e63823.htm
deleted file mode 100644
index e7bd201cd..000000000
--- a/docs/html/8dd2dd01-f5ac-818b-e76b-1c2209e63823.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicEnumerableAsyncExtensions.ToDynamicArrayAsync Method (IEnumerable) DynamicEnumerableAsyncExtensions ToDynamicArrayAsync Method (IEnumerable)
- Async creates an array of dynamic objects from a
IEnumerable .
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/8ed3caeb-f17e-a788-72d5-4ee37624e7d5.htm b/docs/html/8ed3caeb-f17e-a788-72d5-4ee37624e7d5.htm
deleted file mode 100644
index b3258bfb1..000000000
--- a/docs/html/8ed3caeb-f17e-a788-72d5-4ee37624e7d5.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicExpressionParser.ParseLambda Method (ParsingConfig, Boolean, Type, String, Object[])
DynamicExpressionParser ParseLambda Method (ParsingConfig, Boolean, Type, String, Object )
- Parses an expression into a LambdaExpression.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static LambdaExpression ParseLambda (
- ParsingConfig parsingConfig ,
- bool createParameterCtor ,
- Type resultType ,
- string expression ,
- params Object [] values
-)Parameters parsingConfig Type: System.Linq.Dynamic.Core ParsingConfig The Configuration for the parsing. createParameterCtor Type: System Boolean if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. resultType Type: System Type Type of the result. If not specified, it will be generated dynamically. expression Type: System String The expression. values Type: System Object An object array that contains zero or more objects which are used as replacement values. Return Value Type:
LambdaExpression The generated
LambdaExpression See Also
\ No newline at end of file
diff --git a/docs/html/8f200c54-1c0d-42a2-7926-ab1bcb8732b0.htm b/docs/html/8f200c54-1c0d-42a2-7926-ab1bcb8732b0.htm
deleted file mode 100644
index d1e41da94..000000000
--- a/docs/html/8f200c54-1c0d-42a2-7926-ab1bcb8732b0.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicExpressionParser.ParseLambda Method (Type, Type, String, Object[]) DynamicExpressionParser ParseLambda Method (Type, Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static LambdaExpression ParseLambda (
- Type itType ,
- Type resultType ,
- string expression ,
- params Object [] values
-)Parameters itType Type: System Type The main type from the dynamic class expression. resultType Type: System Type Type of the result. If not specified, it will be generated dynamically. expression Type: System String The expression. values Type: System Object An object array that contains zero or more objects which are used as replacement values. Return Value Type:
LambdaExpression The generated
LambdaExpression See Also
\ No newline at end of file
diff --git a/docs/html/8f373d34-e216-398e-a63e-296165a40c5a.htm b/docs/html/8f373d34-e216-398e-a63e-296165a40c5a.htm
deleted file mode 100644
index 3bd684b4c..000000000
--- a/docs/html/8f373d34-e216-398e-a63e-296165a40c5a.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.Select(TResult) Method (Void, TResult, IQueryable, ParsingConfig) DynamicQueryableExtensions SelectTResult Method (Void, TResult , IQueryable, ParsingConfig)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Select``1(System.Void,``0,System.Linq.IQueryable,System.Linq.Dynamic.Core.ParsingConfig)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable Select <TResult>(
- this void source ,
- TResult config ,
- IQueryable selector ,
- params ParsingConfig args
-)
-Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Select``1(System.Void,``0,System.Linq.IQueryable,System.Linq.Dynamic.Core.ParsingConfig)"]
config Type: TResult [Missing <param name="config"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Select``1(System.Void,``0,System.Linq.IQueryable,System.Linq.Dynamic.Core.ParsingConfig)"]
selector Type: System.Linq IQueryable [Missing <param name="selector"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Select``1(System.Void,``0,System.Linq.IQueryable,System.Linq.Dynamic.Core.ParsingConfig)"]
args Type: System.Linq.Dynamic.Core ParsingConfig [Missing <param name="args"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Select``1(System.Void,``0,System.Linq.IQueryable,System.Linq.Dynamic.Core.ParsingConfig)"]
Type Parameters TResult [Missing <typeparam name="TResult"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Select``1(System.Void,``0,System.Linq.IQueryable,System.Linq.Dynamic.Core.ParsingConfig)"]
Return Value Type:
IQueryable T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Select``1(System.Void,``0,System.Linq.IQueryable,System.Linq.Dynamic.Core.ParsingConfig)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/901a4d67-1b67-6548-5c87-421c5a788bd6.htm b/docs/html/901a4d67-1b67-6548-5c87-421c5a788bd6.htm
deleted file mode 100644
index 863f1687b..000000000
--- a/docs/html/901a4d67-1b67-6548-5c87-421c5a788bd6.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
GroupResult.Subgroups Property GroupResult Subgroups Property
- The resulting subgroups in the group.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/9252fe17-2fa4-d444-db5a-4a2a3adaa51f.htm b/docs/html/9252fe17-2fa4-d444-db5a-4a2a3adaa51f.htm
deleted file mode 100644
index 8ff1b9114..000000000
--- a/docs/html/9252fe17-2fa4-d444-db5a-4a2a3adaa51f.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
DynamicQueryableExtensions.SkipWhile Method DynamicQueryableExtensions SkipWhile Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/94081853-6911-cf5a-3e02-6c4ef8c8e633.htm b/docs/html/94081853-6911-cf5a-3e02-6c4ef8c8e633.htm
deleted file mode 100644
index 32f616251..000000000
--- a/docs/html/94081853-6911-cf5a-3e02-6c4ef8c8e633.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
ParseException.Position Property ParseException Position Property
- The location in the parsed string that produced the
ParseException .
-
-
Namespace:
-
System.Linq.Dynamic.Core.Exceptions
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic int Position { get ; }Property Value Type:
Int32 See Also
\ No newline at end of file
diff --git a/docs/html/9427752d-ed04-93d2-b843-12c4601bf12c.htm b/docs/html/9427752d-ed04-93d2-b843-12c4601bf12c.htm
deleted file mode 100644
index f2a232225..000000000
--- a/docs/html/9427752d-ed04-93d2-b843-12c4601bf12c.htm
+++ /dev/null
@@ -1,14 +0,0 @@
-
DynamicQueryableExtensions.OrderBy Method (IQueryable, ParsingConfig, String, Object[]) DynamicQueryableExtensions OrderBy Method (IQueryable, ParsingConfig, String, Object )
- Sorts the elements of a sequence in ascending or descending order according to a key.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax Examplesvar resultSingle = queryable.OrderBy("NumberProperty" );
-var resultSingleDescending = queryable.OrderBy("NumberProperty DESC" );
-var resultMultiple = queryable.OrderBy("NumberProperty, StringProperty DESC" ); See Also
\ No newline at end of file
diff --git a/docs/html/94c5611e-fa6f-58a7-b446-c95aa4b99e92.htm b/docs/html/94c5611e-fa6f-58a7-b446-c95aa4b99e92.htm
deleted file mode 100644
index e88d126bc..000000000
--- a/docs/html/94c5611e-fa6f-58a7-b446-c95aa4b99e92.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
DynamicFunctions Class
- DynamicFunctions (EF.Functions)
-
Inheritance HierarchySystem Object Microsoft.EntityFrameworkCore.DynamicLinq DynamicFunctions
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assemblies:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static class DynamicFunctions See Also
\ No newline at end of file
diff --git a/docs/html/94cfad6d-e734-f70f-3352-98a53c8d947e.htm b/docs/html/94cfad6d-e734-f70f-3352-98a53c8d947e.htm
deleted file mode 100644
index c93b6cb73..000000000
--- a/docs/html/94cfad6d-e734-f70f-3352-98a53c8d947e.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
GroupResult.ToString Method GroupResult ToString Method
- Returns a
String showing the key of the group and the number of items in the group.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic override string ToString ()Return Value Type:
String
- A
String that represents this instance.
-
See Also
\ No newline at end of file
diff --git a/docs/html/96be8c30-44a1-cf11-a1a9-2f162b69f904.htm b/docs/html/96be8c30-44a1-cf11-a1a9-2f162b69f904.htm
deleted file mode 100644
index 6708ca542..000000000
--- a/docs/html/96be8c30-44a1-cf11-a1a9-2f162b69f904.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicExpressionParser.ParseLambda Method (ParameterExpression[], Type, String, Object[]) DynamicExpressionParser ParseLambda Method ( ParameterExpression , Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static LambdaExpression ParseLambda (
- ParameterExpression [] parameters ,
- Type resultType ,
- string expression ,
- params Object [] values
-)Parameters parameters Type: System.Linq.Expressions ParameterExpression A array from ParameterExpressions. resultType Type: System Type Type of the result. If not specified, it will be generated dynamically. expression Type: System String The expression. values Type: System Object An object array that contains zero or more objects which are used as replacement values. Return Value Type:
LambdaExpression The generated
LambdaExpression See Also
\ No newline at end of file
diff --git a/docs/html/97298d8a-a2a0-2a1a-b264-9c3c6d1bee00.htm b/docs/html/97298d8a-a2a0-2a1a-b264-9c3c6d1bee00.htm
deleted file mode 100644
index 108d500f0..000000000
--- a/docs/html/97298d8a-a2a0-2a1a-b264-9c3c6d1bee00.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.AnyAsync Method (IQueryable, CancellationToken) EntityFrameworkDynamicQueryableExtensions AnyAsync Method (IQueryable, CancellationToken)
- Asynchronously determines whether a sequence contains any elements.
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntax Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/97aa85dd-7d55-7d4a-d16c-6151057d4e14.htm b/docs/html/97aa85dd-7d55-7d4a-d16c-6151057d4e14.htm
deleted file mode 100644
index 54445e252..000000000
--- a/docs/html/97aa85dd-7d55-7d4a-d16c-6151057d4e14.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
PagedResult Properties The PagedResult type exposes the following members.
Properties
-
- Name Description CurrentPage
- Gets or sets the current page.
-
PageCount
- Gets or sets the page count.
-
PageSize
- Gets or sets the size of the page.
-
Queryable
- Gets or sets the queryable.
-
RowCount
- Gets or sets the row count.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/97fb97e3-3214-2b41-46d1-12db4af02137.htm b/docs/html/97fb97e3-3214-2b41-46d1-12db4af02137.htm
deleted file mode 100644
index 6f64e5198..000000000
--- a/docs/html/97fb97e3-3214-2b41-46d1-12db4af02137.htm
+++ /dev/null
@@ -1,15 +0,0 @@
-
DynamicQueryableExtensions.Count Method (IQueryable, ParsingConfig, String, Object[]) DynamicQueryableExtensions Count Method (IQueryable, ParsingConfig, String, Object )
- Returns the number of elements in a sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax ExamplesIQueryable queryable = employees.AsQueryable();
-var result1 = queryable.Count("Income > 50" );
-var result2 = queryable.Count("Income > @0" , 50 );
-var result3 = queryable.Select("Roles.Count()" ); See Also
\ No newline at end of file
diff --git a/docs/html/98ec7b39-c188-0dfc-6913-d8833d4a841e.htm b/docs/html/98ec7b39-c188-0dfc-6913-d8833d4a841e.htm
deleted file mode 100644
index 2cbdce9a5..000000000
--- a/docs/html/98ec7b39-c188-0dfc-6913-d8833d4a841e.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicQueryableExtensions.Join(TElement) Method (Void, TElement, IQueryable, Void, TElement, IEnumerable(TElement)) DynamicQueryableExtensions JoinTElement Method (Void, TElement , IQueryable, Void, TElement , IEnumerableTElement )
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Collections.Generic.IEnumerable{``0})"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable Join <TElement>(
- this void outer ,
- TElement inner ,
- IQueryable outerKeySelector ,
- void innerKeySelector ,
- TElement resultSelector ,
- params IEnumerable <TElement> args
-)
-Parameters outer Type: System Void [Missing <param name="outer"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Collections.Generic.IEnumerable{``0})"]
inner Type: TElement [Missing <param name="inner"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Collections.Generic.IEnumerable{``0})"]
outerKeySelector Type: System.Linq IQueryable T [Missing <param name="outerKeySelector"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Collections.Generic.IEnumerable{``0})"]
innerKeySelector Type: System Void [Missing <param name="innerKeySelector"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Collections.Generic.IEnumerable{``0})"]
resultSelector Type: TElement [Missing <param name="resultSelector"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Collections.Generic.IEnumerable{``0})"]
args Type: System.Collections.Generic IEnumerable TElement [Missing <param name="args"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Collections.Generic.IEnumerable{``0})"]
Type Parameters TElement [Missing <typeparam name="TElement"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Collections.Generic.IEnumerable{``0})"]
Return Value Type:
IQueryable T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Join``1(System.Void,``0,System.Linq.IQueryable`1,System.Void,``0,System.Collections.Generic.IEnumerable{``0})"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/98eecc70-2dfd-5365-3d57-1e49a10ba940.htm b/docs/html/98eecc70-2dfd-5365-3d57-1e49a10ba940.htm
deleted file mode 100644
index 6640b64fa..000000000
--- a/docs/html/98eecc70-2dfd-5365-3d57-1e49a10ba940.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
AbstractDynamicLinqCustomTypeProvider.ResolveType Method AbstractDynamicLinqCustomTypeProvider ResolveType Method
- Resolve any type which is registered in the current application domain.
-
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/99445602-946e-1678-2afd-18cc8e70eec6.htm b/docs/html/99445602-946e-1678-2afd-18cc8e70eec6.htm
deleted file mode 100644
index aa1073e8e..000000000
--- a/docs/html/99445602-946e-1678-2afd-18cc8e70eec6.htm
+++ /dev/null
@@ -1,22 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.SingleOrDefaultAsync Method (IQueryable, CancellationToken, String, Object[]) EntityFrameworkDynamicQueryableExtensions SingleOrDefaultAsync Method (IQueryable, CancellationToken, String, Object )
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > SingleOrDefaultAsync (
- this IQueryable source ,
- CancellationToken cancellationToken ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the single element of.
- cancellationToken Type: System.Threading CancellationToken
- A CancellationToken to observe while waiting for the task to complete.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation. The task result contains the single element of the input sequence that satisfies the condition in
predicate , or default if no such element is found.
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/9b48256e-3052-d01e-df06-deb7bae66d93.htm b/docs/html/9b48256e-3052-d01e-df06-deb7bae66d93.htm
deleted file mode 100644
index 92b03483b..000000000
--- a/docs/html/9b48256e-3052-d01e-df06-deb7bae66d93.htm
+++ /dev/null
@@ -1,21 +0,0 @@
-
DynamicQueryableExtensions.SelectMany Method (IQueryable, ParsingConfig, String, String, Object[], Object[]) DynamicQueryableExtensions SelectMany Method (IQueryable, ParsingConfig, String, String, Object , Object )
- Projects each element of a sequence to an
IQueryable
- and invokes a result selector function on each element therein. The resulting
- values from each intermediate sequence are combined into a single, one-dimensional
- sequence and returned.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable SelectMany (
- this IQueryable source ,
- ParsingConfig config ,
- string collectionSelector ,
- string resultSelector ,
- Object [] collectionSelectorArgs = null ,
- params Object [] resultSelectorArgs
-)Parameters source Type: System.Linq IQueryable A sequence of values to project. config Type: System.Linq.Dynamic.Core ParsingConfig The ParsingConfig . collectionSelector Type: System String A projection function to apply to each element of the input sequence. resultSelector Type: System String A projection function to apply to each element of each intermediate sequence. Should only use x and y as parameter names. collectionSelectorArgs (Optional)Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. resultSelectorArgs Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable
- An
IQueryable whose elements are the result of invoking the one-to-many
- projection function
collectionSelector on each element of source and then mapping
- each of those sequence elements and their corresponding source element to a result element.
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Examples See Also
\ No newline at end of file
diff --git a/docs/html/9bafb854-4a07-e4fe-0945-b4c2c40e3d9e.htm b/docs/html/9bafb854-4a07-e4fe-0945-b4c2c40e3d9e.htm
deleted file mode 100644
index 46793fd7f..000000000
--- a/docs/html/9bafb854-4a07-e4fe-0945-b4c2c40e3d9e.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicQueryableExtensions.FirstOrDefault Method (IQueryable, ParsingConfig, String, Object[]) DynamicQueryableExtensions FirstOrDefault Method (IQueryable, ParsingConfig, String, Object )
- Returns the first element of a sequence that satisfies a specified condition or a default value if no such element is found.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static Object FirstOrDefault (
- this IQueryable source ,
- ParsingConfig config ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable The IQueryable to return the first element of. config Type: System.Linq.Dynamic.Core ParsingConfig The ParsingConfig . predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Object default if source is empty or if no element passes the test specified by predicate; otherwise, the first element in source that passes the test specified by predicate.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/9d0014ca-516c-287a-f70c-988ee9668b30.htm b/docs/html/9d0014ca-516c-287a-f70c-988ee9668b30.htm
deleted file mode 100644
index a97e03c40..000000000
--- a/docs/html/9d0014ca-516c-287a-f70c-988ee9668b30.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
IDynamicLinkCustomTypeProvider.ResolveTypeBySimpleName Method IDynamicLinkCustomTypeProvider ResolveTypeBySimpleName Method
- Resolve any type by the simple name which is registered in the current application domain.
-
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
SyntaxType ResolveTypeBySimpleName (
- string simpleTypeName
-)Parameters simpleTypeName Type: System String The typename to resolve. Return Value Type:
Type A resolved
Type or null when not found.
See Also
\ No newline at end of file
diff --git a/docs/html/9e3aa1e6-1f42-4ee4-2f95-465f90028816.htm b/docs/html/9e3aa1e6-1f42-4ee4-2f95-465f90028816.htm
deleted file mode 100644
index b48a401d8..000000000
--- a/docs/html/9e3aa1e6-1f42-4ee4-2f95-465f90028816.htm
+++ /dev/null
@@ -1,22 +0,0 @@
-
DynamicQueryableExtensions.SelectMany Method (IQueryable, String, String, String, String, Object[], Object[]) DynamicQueryableExtensions SelectMany Method (IQueryable, String, String, String, String, Object , Object )
- Projects each element of a sequence to an
IQueryable
- and invokes a result selector function on each element therein. The resulting
- values from each intermediate sequence are combined into a single, one-dimensional
- sequence and returned.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable SelectMany (
- this IQueryable source ,
- string collectionSelector ,
- string resultSelector ,
- string collectionParameterName ,
- string resultParameterName ,
- Object [] collectionSelectorArgs = null ,
- params Object [] resultSelectorArgs
-)Parameters source Type: System.Linq IQueryable A sequence of values to project. collectionSelector Type: System String A projection function to apply to each element of the input sequence. resultSelector Type: System String A projection function to apply to each element of each intermediate sequence. collectionParameterName Type: System String The name from collectionParameter to use. Default is x. resultParameterName Type: System String The name from resultParameterName to use. Default is y. collectionSelectorArgs (Optional)Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. resultSelectorArgs Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable
- An
IQueryable whose elements are the result of invoking the one-to-many
- projection function
collectionSelector on each element of source and then mapping
- each of those sequence elements and their corresponding source element to a result element.
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Examples See Also
\ No newline at end of file
diff --git a/docs/html/9ef43177-e01a-9e3d-37e6-258a482c680a.htm b/docs/html/9ef43177-e01a-9e3d-37e6-258a482c680a.htm
deleted file mode 100644
index ef6f4800a..000000000
--- a/docs/html/9ef43177-e01a-9e3d-37e6-258a482c680a.htm
+++ /dev/null
@@ -1,8 +0,0 @@
-
ParsingConfig.UseParameterizedNamesInDynamicQuery Property ParsingConfig UseParameterizedNamesInDynamicQuery Property
- Use Parameterized Names in generated dynamic SQL query. Default set to false.
- See https://github.com/graeme-hill/gblog/blob/master/source_content/articles/2014.139_entity-framework-dynamic-queries-and-parameterization.mkd
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic bool UseParameterizedNamesInDynamicQuery { get ; set ; }Property Value Type:
Boolean See Also
\ No newline at end of file
diff --git a/docs/html/9f491ab7-fef4-6562-7d05-68649113953a.htm b/docs/html/9f491ab7-fef4-6562-7d05-68649113953a.htm
deleted file mode 100644
index 0710fec61..000000000
--- a/docs/html/9f491ab7-fef4-6562-7d05-68649113953a.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.Select(TResult) Method (Void, TResult, IQueryable) DynamicQueryableExtensions SelectTResult Method (Void, TResult , IQueryable)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Select``1(System.Void,``0,System.Linq.IQueryable)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable Select <TResult>(
- this void source ,
- TResult selector ,
- params IQueryable args
-)
-Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Select``1(System.Void,``0,System.Linq.IQueryable)"]
selector Type: TResult [Missing <param name="selector"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Select``1(System.Void,``0,System.Linq.IQueryable)"]
args Type: System.Linq IQueryable [Missing <param name="args"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Select``1(System.Void,``0,System.Linq.IQueryable)"]
Type Parameters TResult [Missing <typeparam name="TResult"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Select``1(System.Void,``0,System.Linq.IQueryable)"]
Return Value Type:
IQueryable T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Select``1(System.Void,``0,System.Linq.IQueryable)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/9fad9d05-8e5d-bafc-fc03-47db3d1c7253.htm b/docs/html/9fad9d05-8e5d-bafc-fc03-47db3d1c7253.htm
deleted file mode 100644
index 5efe7cd85..000000000
--- a/docs/html/9fad9d05-8e5d-bafc-fc03-47db3d1c7253.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicQueryableExtensions.Last Method (IQueryable, ParsingConfig, String, Object[]) DynamicQueryableExtensions Last Method (IQueryable, ParsingConfig, String, Object )
- Returns the last element of a sequence that satisfies a specified condition.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/9fca694c-b3f8-dce0-ddfb-747f4de298a5.htm b/docs/html/9fca694c-b3f8-dce0-ddfb-747f4de298a5.htm
deleted file mode 100644
index 98f3ff8d9..000000000
--- a/docs/html/9fca694c-b3f8-dce0-ddfb-747f4de298a5.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DefaultQueryableAnalyzer.SupportsLinqToObjects Method DefaultQueryableAnalyzer SupportsLinqToObjects Method
- Determines whether the specified query (and provider) supports LinqToObjects.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/GeneralError.htm b/docs/html/GeneralError.htm
deleted file mode 100644
index fce110ece..000000000
--- a/docs/html/GeneralError.htm
+++ /dev/null
@@ -1,29 +0,0 @@
-
-
-
-
-
-
-
-
-
General Error
-
-
-
-
-
-
-
-
-
-
-
-
We're sorry, a general error has occurred.
-
Please try to load the page again. If the error persists, please contact the site administrator.
-
-
-
-
diff --git a/docs/html/PageNotFound.htm b/docs/html/PageNotFound.htm
deleted file mode 100644
index 107650202..000000000
--- a/docs/html/PageNotFound.htm
+++ /dev/null
@@ -1,31 +0,0 @@
-
-
-
-
-
-
-
-
-
Page Not Found
-
-
-
-
-
-
-
-
-
-
-
-
We're sorry, the page you requested cannot be found.
-
The URL might be misspelled or the page you are looking for is no longer available. If you entered
-the web address, check that it doesn't contain a typo. You can use the search box at the top of the page to
-try and locate the page.
-
-
-
-
diff --git a/docs/html/a05fe883-3a66-89c9-9fce-6ea5c8d8d8d5.htm b/docs/html/a05fe883-3a66-89c9-9fce-6ea5c8d8d8d5.htm
deleted file mode 100644
index 059e5cf0a..000000000
--- a/docs/html/a05fe883-3a66-89c9-9fce-6ea5c8d8d8d5.htm
+++ /dev/null
@@ -1,21 +0,0 @@
-
DynamicQueryableExtensions.GroupBy Method DynamicQueryableExtensions GroupBy Method
Overload List
-
- Name Description GroupBy(IQueryable, String, Object )
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupBy(IQueryable, String, String)
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupBy(IQueryable, ParsingConfig, String, Object )
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupBy(IQueryable, ParsingConfig, String, String)
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupBy(IQueryable, String, String, Object )
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupBy(IQueryable, ParsingConfig, String, String, Object )
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/a25424f0-7800-a591-fd75-1937b7d2df64.htm b/docs/html/a25424f0-7800-a591-fd75-1937b7d2df64.htm
deleted file mode 100644
index 3527cee1a..000000000
--- a/docs/html/a25424f0-7800-a591-fd75-1937b7d2df64.htm
+++ /dev/null
@@ -1,18 +0,0 @@
-
DynamicClassFactory.CreateType Method DynamicClassFactory CreateType Method
- The CreateType method creates a new data class with a given set of public properties and returns the System.Type object for the newly created class. If a data class with an identical sequence of properties has already been created, the System.Type object for this class is returned.
- Data classes implement private instance variables and read/write property accessors for the specified properties.Data classes also override the Equals and GetHashCode members to implement by-value equality.
- Data classes are created in an in-memory assembly in the current application domain. All data classes inherit from
DynamicClass and are given automatically generated names that should be considered private (the names will be unique within the application domain but not across multiple invocations of the application). Note that once created, a data class stays in memory for the lifetime of the current application domain. There is currently no way to unload a dynamically created data class.
- The dynamic expression parser uses the CreateClass methods to generate classes from data object initializers. This feature in turn is often used with the dynamic Select method to create projections.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static Type CreateType (
- IList <DynamicProperty > properties ,
- bool createParameterCtor = true
-)Parameters properties Type: System.Collections.Generic IList DynamicProperty The DynamicProperties createParameterCtor (Optional)Type: System Boolean Create a constructor with parameters. Default set to true. Note that for Linq-to-Database objects, this needs to be set to false. Return Value Type:
Type Type
ExamplesDynamicProperty[] props = new DynamicProperty[] { new DynamicProperty("Name" , typeof (string )), new DynamicProperty("Birthday" , typeof (DateTime)) };
-Type type = DynamicClassFactory.CreateType(props);
-DynamicClass dynamicClass = Activator.CreateInstance(type) as DynamicClass;
-dynamicClass.SetDynamicProperty("Name" , "Albert" );
-dynamicClass.SetDynamicProperty("Birthday" , new DateTime(1879 , 3 , 14 ));
-Console.WriteLine(dynamicClass); See Also
\ No newline at end of file
diff --git a/docs/html/a2968e7a-28c6-4e4a-97a7-bd7ce4b74499.htm b/docs/html/a2968e7a-28c6-4e4a-97a7-bd7ce4b74499.htm
deleted file mode 100644
index d97d0b093..000000000
--- a/docs/html/a2968e7a-28c6-4e4a-97a7-bd7ce4b74499.htm
+++ /dev/null
@@ -1,19 +0,0 @@
-
AbstractDynamicLinqCustomTypeProvider Class AbstractDynamicLinqCustomTypeProvider Class
- The abstract DynamicLinqCustomTypeProvider which is used by the DefaultDynamicLinqCustomTypeProvider and can be used by a custom TypeProvider like in .NET Core.
-
Inheritance Hierarchy
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic abstract class AbstractDynamicLinqCustomTypeProvider The AbstractDynamicLinqCustomTypeProvider type exposes the following members.
Constructors Methods See Also
\ No newline at end of file
diff --git a/docs/html/a56645d1-6f20-cd49-ca71-6705862d3c0c.htm b/docs/html/a56645d1-6f20-cd49-ca71-6705862d3c0c.htm
deleted file mode 100644
index 83fa8245f..000000000
--- a/docs/html/a56645d1-6f20-cd49-ca71-6705862d3c0c.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.PageResult Method (IQueryable, Int32, Int32) DynamicQueryableExtensions PageResult Method (IQueryable, Int32, Int32)
- Returns the elements as paged and include the CurrentPage, PageCount, PageSize and RowCount.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/a5ecbe15-aade-af7f-4860-6c5c412a34b4.htm b/docs/html/a5ecbe15-aade-af7f-4860-6c5c412a34b4.htm
deleted file mode 100644
index 8799b95c5..000000000
--- a/docs/html/a5ecbe15-aade-af7f-4860-6c5c412a34b4.htm
+++ /dev/null
@@ -1,213 +0,0 @@
-
DynamicQueryableExtensions Class DynamicQueryableExtensions Class
- Provides a set of static (Shared in Visual Basic) methods for querying data structures that implement
IQueryable .
- It allows dynamic string based querying. Very handy when, at compile time, you don't know the type of queries that will be generated,
- or when downstream components only return column names to sort and filter by.
-
Inheritance HierarchySystem Object System.Linq.Dynamic.Core DynamicQueryableExtensions
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static class DynamicQueryableExtensions The DynamicQueryableExtensions type exposes the following members.
Methods
-
- Name Description Aggregate
- Dynamically runs an aggregate function on the IQueryable.
-
Any(IQueryable)
- Determines whether a sequence contains any elements.
-
Any(IQueryable, LambdaExpression)
- Determines whether a sequence contains any elements.
-
Any(IQueryable, String, Object )
- Determines whether a sequence contains any elements.
-
Any(IQueryable, ParsingConfig, String, Object )
- Determines whether a sequence contains any elements.
-
AsEnumerable Cast(IQueryable, String)
- Converts the elements of an
IQueryable to the specified type.
-
Cast(IQueryable, Type)
- Converts the elements of an
IQueryable to the specified type.
-
Cast(IQueryable, ParsingConfig, String)
- Converts the elements of an
IQueryable to the specified type.
-
Count(IQueryable)
- Returns the number of elements in a sequence.
-
Count(IQueryable, LambdaExpression)
- Returns the number of elements in a sequence.
-
Count(IQueryable, String, Object )
- Returns the number of elements in a sequence.
-
Count(IQueryable, ParsingConfig, String, Object )
- Returns the number of elements in a sequence.
-
DefaultIfEmpty(IQueryable)
- Returns the elements of the specified sequence or the type parameter's default value in a singleton collection if the sequence is empty.
-
DefaultIfEmpty(IQueryable, Object)
- Returns the elements of the specified sequence or the type parameter's default value in a singleton collection if the sequence is empty.
-
Distinct
- Returns distinct elements from a sequence by using the default equality comparer to compare values.
-
First(IQueryable)
- Returns the first element of a sequence.
-
First(IQueryable, LambdaExpression)
- Returns the first element of a sequence that satisfies a specified condition.
-
First(IQueryable, String, Object )
- Returns the first element of a sequence that satisfies a specified condition.
-
First(IQueryable, ParsingConfig, String, Object )
- Returns the first element of a sequence that satisfies a specified condition.
-
FirstOrDefault(IQueryable)
- Returns the first element of a sequence, or a default value if the sequence contains no elements.
-
FirstOrDefault(IQueryable, LambdaExpression)
- Returns the first element of a sequence that satisfies a specified condition or a default value if no such element is found.
-
FirstOrDefault(IQueryable, String, Object )
- Returns the first element of a sequence that satisfies a specified condition or a default value if no such element is found.
-
FirstOrDefault(IQueryable, ParsingConfig, String, Object )
- Returns the first element of a sequence that satisfies a specified condition or a default value if no such element is found.
-
GroupBy(IQueryable, String, Object )
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupBy(IQueryable, String, String)
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupBy(IQueryable, ParsingConfig, String, Object )
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupBy(IQueryable, ParsingConfig, String, String)
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupBy(IQueryable, String, String, Object )
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupBy(IQueryable, ParsingConfig, String, String, Object )
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
GroupByMany TElement (IEnumerable TElement , Func TElement, Object )
- Groups the elements of a sequence according to multiple specified key functions
- and creates a result value from each group (and subgroups) and its key.
-
GroupByMany TElement (IEnumerable TElement , String )
- Groups the elements of a sequence according to multiple specified key string functions
- and creates a result value from each group (and subgroups) and its key.
-
GroupByMany TElement (IEnumerable TElement , ParsingConfig, String )
- Groups the elements of a sequence according to multiple specified key string functions
- and creates a result value from each group (and subgroups) and its key.
-
GroupJoin(IQueryable, IEnumerable, String, String, String, Object )
- Correlates the elements of two sequences based on equality of keys and groups the results. The default equality comparer is used to compare keys.
-
GroupJoin(IQueryable, ParsingConfig, IEnumerable, String, String, String, Object )
- Correlates the elements of two sequences based on equality of keys and groups the results. The default equality comparer is used to compare keys.
-
Join(IQueryable, IEnumerable, String, String, String, Object )
- Correlates the elements of two sequences based on matching keys. The default equality comparer is used to compare keys.
-
Join(IQueryable, ParsingConfig, IEnumerable, String, String, String, Object )
- Correlates the elements of two sequences based on matching keys. The default equality comparer is used to compare keys.
-
Join TElement (Void, TElement, IQueryable T , Void, TElement, IEnumerable TElement ) Join TElement (Void, TElement, IQueryable T , Void, TElement, ParsingConfig, IEnumerable TElement ) Last(IQueryable)
- Returns the last element of a sequence.
-
Last(IQueryable, LambdaExpression)
- Returns the last element of a sequence that satisfies a specified condition.
-
Last(IQueryable, String, Object )
- Returns the last element of a sequence that satisfies a specified condition.
-
Last(IQueryable, ParsingConfig, String, Object )
- Returns the last element of a sequence that satisfies a specified condition.
-
LastOrDefault(IQueryable)
- Returns the last element of a sequence, or a default value if the sequence contains no elements.
-
LastOrDefault(IQueryable, LambdaExpression)
- Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements.
-
LastOrDefault(IQueryable, String, Object )
- Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements.
-
LastOrDefault(IQueryable, ParsingConfig, String, Object )
- Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements.
-
OfType(IQueryable, String)
- Filters the elements of an
IQueryable based on a specified type.
-
OfType(IQueryable, Type)
- Filters the elements of an
IQueryable based on a specified type.
-
OfType(IQueryable, ParsingConfig, String)
- Filters the elements of an
IQueryable based on a specified type.
-
OrderBy(IQueryable, String, Object )
- Sorts the elements of a sequence in ascending or descending order according to a key.
-
OrderBy(IQueryable, ParsingConfig, String, Object )
- Sorts the elements of a sequence in ascending or descending order according to a key.
-
OrderBy TSource (Void, TSource, IQueryable T ) OrderBy TSource (Void, TSource, IQueryable T , Void) Page(IQueryable, Int32, Int32)
- Returns the elements as paged.
-
Page TSource (Void, TSource, IQueryable T ) PageResult(IQueryable, Int32, Int32)
- Returns the elements as paged and include the CurrentPage, PageCount, PageSize and RowCount.
-
PageResult TSource (IQueryable T , Void, TSource) Reverse
- Inverts the order of the elements in a sequence.
-
Select(IQueryable, String, Object )
- Projects each element of a sequence into a new form.
-
Select(IQueryable, ParsingConfig, String, Object )
- Projects each element of a sequence into a new form.
-
Select(IQueryable, Type, String, Object )
- Projects each element of a sequence into a new class of type TResult.
- Details see http://solutionizing.net/category/linq/
-
Select(IQueryable, ParsingConfig, Type, String, Object )
- Projects each element of a sequence into a new class of type TResult.
- Details see http://solutionizing.net/category/linq/
-
Select TResult (Void, TResult, IQueryable) Select TResult (Void, TResult, IQueryable, ParsingConfig) SelectMany(IQueryable, String, Object )
- Projects each element of a sequence to an
IQueryable and combines the resulting sequences into one sequence.
-
SelectMany(IQueryable, ParsingConfig, String, Object )
- Projects each element of a sequence to an
IQueryable and combines the resulting sequences into one sequence.
-
SelectMany(IQueryable, Type, String, Object )
- Projects each element of a sequence to an
IQueryable and combines the resulting sequences into one sequence.
-
SelectMany(IQueryable, ParsingConfig, Type, String, Object )
- Projects each element of a sequence to an
IQueryable and combines the resulting sequences into one sequence.
-
SelectMany(IQueryable, String, String, Object , Object )
- Projects each element of a sequence to an
IQueryable
- and invokes a result selector function on each element therein. The resulting
- values from each intermediate sequence are combined into a single, one-dimensional
- sequence and returned.
-
SelectMany(IQueryable, ParsingConfig, String, String, Object , Object )
- Projects each element of a sequence to an
IQueryable
- and invokes a result selector function on each element therein. The resulting
- values from each intermediate sequence are combined into a single, one-dimensional
- sequence and returned.
-
SelectMany(IQueryable, String, String, String, String, Object , Object )
- Projects each element of a sequence to an
IQueryable
- and invokes a result selector function on each element therein. The resulting
- values from each intermediate sequence are combined into a single, one-dimensional
- sequence and returned.
-
SelectMany(IQueryable, ParsingConfig, String, String, String, String, Object , Object )
- Projects each element of a sequence to an
IQueryable
- and invokes a result selector function on each element therein. The resulting
- values from each intermediate sequence are combined into a single, one-dimensional
- sequence and returned.
-
SelectMany TResult (Void, TResult, IQueryable) SelectMany TResult (Void, TResult, IQueryable, ParsingConfig) Single(IQueryable)
- Returns the only element of a sequence, and throws an exception if there
- is not exactly one element in the sequence.
-
Single(IQueryable, LambdaExpression)
- Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there
- is not exactly one element in the sequence.
-
Single(IQueryable, String, Object )
- Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there
- is not exactly one element in the sequence.
-
Single(IQueryable, ParsingConfig, String, Object )
- Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there
- is not exactly one element in the sequence.
-
SingleOrDefault(IQueryable)
- Returns the only element of a sequence, or a default value if the sequence
- is empty; this method throws an exception if there is more than one element
- in the sequence.
-
SingleOrDefault(IQueryable, LambdaExpression)
- Returns the only element of a sequence that satisfies a specified condition or a default value if the sequence
- is empty; and throws an exception if there is not exactly one element in the sequence.
-
SingleOrDefault(IQueryable, String, Object )
- Returns the only element of a sequence that satisfies a specified condition or a default value if the sequence
- is empty; and throws an exception if there is not exactly one element in the sequence.
-
SingleOrDefault(IQueryable, ParsingConfig, String, Object )
- Returns the only element of a sequence that satisfies a specified condition or a default value if the sequence
- is empty; and throws an exception if there is not exactly one element in the sequence.
-
Skip
- Bypasses a specified number of elements in a sequence and then returns the remaining elements.
-
SkipWhile(IQueryable, String, Object )
- Bypasses elements in a sequence as long as a specified condition is true and then returns the remaining elements.
-
SkipWhile(IQueryable, ParsingConfig, String, Object )
- Bypasses elements in a sequence as long as a specified condition is true and then returns the remaining elements.
-
Sum
- Computes the sum of a sequence of numeric values.
-
Take
- Returns a specified number of contiguous elements from the start of a sequence.
-
TakeWhile(IQueryable, String, Object )
- Returns elements from a sequence as long as a specified condition is true.
-
TakeWhile(IQueryable, ParsingConfig, String, Object )
- Returns elements from a sequence as long as a specified condition is true.
-
ThenBy(IOrderedQueryable, String, Object )
- Performs a subsequent ordering of the elements in a sequence in ascending order according to a key.
-
ThenBy(IOrderedQueryable, ParsingConfig, String, Object )
- Performs a subsequent ordering of the elements in a sequence in ascending order according to a key.
-
ThenBy TSource (Void, TSource, IOrderedQueryable T ) ThenBy TSource (Void, TSource, IOrderedQueryable T , Void) Where(IQueryable, LambdaExpression)
- Filters a sequence of values based on a predicate.
-
Where(IQueryable, String, Object )
- Filters a sequence of values based on a predicate.
-
Where(IQueryable, ParsingConfig, String, Object )
- Filters a sequence of values based on a predicate.
-
Where TSource (Void, TSource, IQueryable T ) Where TSource (Void, TSource, IQueryable T , Void)
Top See Also
\ No newline at end of file
diff --git a/docs/html/a8ba3814-05f4-78f5-3342-df80bc14992c.htm b/docs/html/a8ba3814-05f4-78f5-3342-df80bc14992c.htm
deleted file mode 100644
index 662194abb..000000000
--- a/docs/html/a8ba3814-05f4-78f5-3342-df80bc14992c.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
DynamicQueryableExtensions.PageResult Method DynamicQueryableExtensions PageResult Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/a98ac9bb-ddc6-b369-68f9-8ba2b6cc6f5b.htm b/docs/html/a98ac9bb-ddc6-b369-68f9-8ba2b6cc6f5b.htm
deleted file mode 100644
index a35783411..000000000
--- a/docs/html/a98ac9bb-ddc6-b369-68f9-8ba2b6cc6f5b.htm
+++ /dev/null
@@ -1,23 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.AnyAsync Method (IQueryable, String, CancellationToken, Object[]) EntityFrameworkDynamicQueryableExtensions AnyAsync Method (IQueryable, String, CancellationToken, Object )
- Asynchronously determines whether any element of a sequence satisfies a condition.
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <bool > AnyAsync (
- this IQueryable source ,
- string predicate ,
- CancellationToken cancellationToken = null ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable whose elements to test for a condition.
- predicate Type: System String A function to test each element for a condition. cancellationToken (Optional)Type: System.Threading CancellationToken
- A CancellationToken to observe while waiting for the task to complete.
- args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Boolean
- A task that represents the asynchronous operation.
- The task result contains
true if any elements in the source sequence pass the test in the specified
- predicate; otherwise,
false .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/a9aaca32-c004-9567-8470-009b725fb966.htm b/docs/html/a9aaca32-c004-9567-8470-009b725fb966.htm
deleted file mode 100644
index 504e6d887..000000000
--- a/docs/html/a9aaca32-c004-9567-8470-009b725fb966.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicQueryableExtensions.First Method (IQueryable, ParsingConfig, String, Object[]) DynamicQueryableExtensions First Method (IQueryable, ParsingConfig, String, Object )
- Returns the first element of a sequence that satisfies a specified condition.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/a9b9c3c4-e23e-87d4-d365-fb08cd5a94eb.htm b/docs/html/a9b9c3c4-e23e-87d4-d365-fb08cd5a94eb.htm
deleted file mode 100644
index 80388e897..000000000
--- a/docs/html/a9b9c3c4-e23e-87d4-d365-fb08cd5a94eb.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.Any Method (IQueryable) DynamicQueryableExtensions Any Method (IQueryable)
- Determines whether a sequence contains any elements.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax ExamplesIQueryable queryable = employees.AsQueryable();
-var result = queryable.Any(); See Also
\ No newline at end of file
diff --git a/docs/html/aa03af81-60f2-59e1-1323-38d89a865c13.htm b/docs/html/aa03af81-60f2-59e1-1323-38d89a865c13.htm
deleted file mode 100644
index db4568627..000000000
--- a/docs/html/aa03af81-60f2-59e1-1323-38d89a865c13.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicExpressionParser.ParseLambda(T, TResult) Method (Void, Func(T, TResult), ParsingConfig, Boolean)
DynamicExpressionParser ParseLambdaT , TResult Method (Void, FuncT , TResult , ParsingConfig, Boolean)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``2(System.Void,System.Func{``0,``1},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static Expression ParseLambda <T, TResult>(
- void parsingConfig ,
- Func <T, TResult> createParameterCtor ,
- ParsingConfig expression ,
- params bool values
-)
-Parameters parsingConfig Type: System Void [Missing <param name="parsingConfig"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``2(System.Void,System.Func{``0,``1},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean)"]
createParameterCtor Type: System Func T , TResult [Missing <param name="createParameterCtor"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``2(System.Void,System.Func{``0,``1},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean)"]
expression Type: System.Linq.Dynamic.Core ParsingConfig [Missing <param name="expression"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``2(System.Void,System.Func{``0,``1},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean)"]
values Type: System Boolean [Missing <param name="values"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``2(System.Void,System.Func{``0,``1},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean)"]
Type Parameters T [Missing <typeparam name="T"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``2(System.Void,System.Func{``0,``1},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean)"]
TResult [Missing <typeparam name="TResult"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``2(System.Void,System.Func{``0,``1},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean)"]
Return Value Type:
Expression TDelegate [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``2(System.Void,System.Func{``0,``1},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean)"]
See Also
\ No newline at end of file
diff --git a/docs/html/ab68ddf5-0a51-c8e1-0749-2387ce71e6ff.htm b/docs/html/ab68ddf5-0a51-c8e1-0749-2387ce71e6ff.htm
deleted file mode 100644
index 5482f50af..000000000
--- a/docs/html/ab68ddf5-0a51-c8e1-0749-2387ce71e6ff.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.ThenBy(TSource) Method (Void, TSource, IOrderedQueryable) DynamicQueryableExtensions ThenByTSource Method (Void, TSource , IOrderedQueryable)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.ThenBy``1(System.Void,``0,System.Linq.IOrderedQueryable`1)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IOrderedQueryable ThenBy <TSource>(
- this void source ,
- TSource ordering ,
- params IOrderedQueryable args
-)
-Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.ThenBy``1(System.Void,``0,System.Linq.IOrderedQueryable`1)"]
ordering Type: TSource [Missing <param name="ordering"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.ThenBy``1(System.Void,``0,System.Linq.IOrderedQueryable`1)"]
args Type: System.Linq IOrderedQueryable T [Missing <param name="args"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.ThenBy``1(System.Void,``0,System.Linq.IOrderedQueryable`1)"]
Type Parameters TSource [Missing <typeparam name="TSource"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.ThenBy``1(System.Void,``0,System.Linq.IOrderedQueryable`1)"]
Return Value Type:
IOrderedQueryable T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.ThenBy``1(System.Void,``0,System.Linq.IOrderedQueryable`1)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/ad4e3af4-79a0-24d7-96bb-4e9cc7318ecc.htm b/docs/html/ad4e3af4-79a0-24d7-96bb-4e9cc7318ecc.htm
deleted file mode 100644
index 387d1a541..000000000
--- a/docs/html/ad4e3af4-79a0-24d7-96bb-4e9cc7318ecc.htm
+++ /dev/null
@@ -1,21 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.FirstOrDefaultAsync Method (IQueryable, CancellationToken) EntityFrameworkDynamicQueryableExtensions FirstOrDefaultAsync Method (IQueryable, CancellationToken)
- Asynchronously returns the first element of a sequence, or a default value if the sequence contains no elements.
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntax Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/adefc6a7-8218-9f28-b97d-48af4d437fca.htm b/docs/html/adefc6a7-8218-9f28-b97d-48af4d437fca.htm
deleted file mode 100644
index 71228db40..000000000
--- a/docs/html/adefc6a7-8218-9f28-b97d-48af4d437fca.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.FirstAsync Method (IQueryable, String, Object[]) EntityFrameworkDynamicQueryableExtensions FirstAsync Method (IQueryable, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition.
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > FirstAsync (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the first element of.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation.
- The task result contains the first element in
source that passes the test in
-
predicate .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/b0e704dc-35d9-b829-65eb-5c8ca6457ba9.htm b/docs/html/b0e704dc-35d9-b829-65eb-5c8ca6457ba9.htm
deleted file mode 100644
index e49021964..000000000
--- a/docs/html/b0e704dc-35d9-b829-65eb-5c8ca6457ba9.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicQueryableExtensions.Reverse Method DynamicQueryableExtensions Reverse Method
- Inverts the order of the elements in a sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/b31fb887-ec5e-90c5-2043-f9e8008f4089.htm b/docs/html/b31fb887-ec5e-90c5-2043-f9e8008f4089.htm
deleted file mode 100644
index 1b91e9f20..000000000
--- a/docs/html/b31fb887-ec5e-90c5-2043-f9e8008f4089.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicQueryableExtensions.TakeWhile Method (IQueryable, String, Object[]) DynamicQueryableExtensions TakeWhile Method (IQueryable, String, Object )
- Returns elements from a sequence as long as a specified condition is true.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable TakeWhile (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable A sequence to check for being empty. predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable An
IQueryable that contains elements from the input sequence occurring before the element at which the test specified by predicate no longer passes.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
ExamplesIQueryable queryable = employees.AsQueryable();
-var result1 = queryable.TakeWhile("Income > 50" );
-var result2 = queryable.TakeWhile("Income > @0" , 50 ); See Also
\ No newline at end of file
diff --git a/docs/html/b4db88ae-5d05-c16e-3934-a647e67baa4d.htm b/docs/html/b4db88ae-5d05-c16e-3934-a647e67baa4d.htm
deleted file mode 100644
index 366e36775..000000000
--- a/docs/html/b4db88ae-5d05-c16e-3934-a647e67baa4d.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicQueryableExtensions.First Method (IQueryable) DynamicQueryableExtensions First Method (IQueryable)
- Returns the first element of a sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/b5bb5377-cb98-da08-a5db-732905ff323e.htm b/docs/html/b5bb5377-cb98-da08-a5db-732905ff323e.htm
deleted file mode 100644
index 25fb3bed8..000000000
--- a/docs/html/b5bb5377-cb98-da08-a5db-732905ff323e.htm
+++ /dev/null
@@ -1,19 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.SingleOrDefaultAsync Method (IQueryable, String, Object[]) EntityFrameworkDynamicQueryableExtensions SingleOrDefaultAsync Method (IQueryable, String, Object )
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > SingleOrDefaultAsync (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the single element of.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation. The task result contains the single element of the input sequence that satisfies the condition in
predicate , or default if no such element is found.
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/b5d6ef5a-f11d-2f52-63d2-e7107c905aa6.htm b/docs/html/b5d6ef5a-f11d-2f52-63d2-e7107c905aa6.htm
deleted file mode 100644
index f839e908c..000000000
--- a/docs/html/b5d6ef5a-f11d-2f52-63d2-e7107c905aa6.htm
+++ /dev/null
@@ -1,14 +0,0 @@
-
DynamicExpressionParser.ParseLambda Method (ParsingConfig, Boolean, Type, Type, String, Object[])
DynamicExpressionParser ParseLambda Method (ParsingConfig, Boolean, Type, Type, String, Object )
- Parses an expression into a LambdaExpression.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static LambdaExpression ParseLambda (
- ParsingConfig parsingConfig ,
- bool createParameterCtor ,
- Type itType ,
- Type resultType ,
- string expression ,
- params Object [] values
-)Parameters parsingConfig Type: System.Linq.Dynamic.Core ParsingConfig The Configuration for the parsing. createParameterCtor Type: System Boolean if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. itType Type: System Type The main type from the dynamic class expression. resultType Type: System Type Type of the result. If not specified, it will be generated dynamically. expression Type: System String The expression. values Type: System Object An object array that contains zero or more objects which are used as replacement values. Return Value Type:
LambdaExpression The generated
LambdaExpression See Also
\ No newline at end of file
diff --git a/docs/html/b63dbea1-f9be-1fa1-df74-ecdd281c06c7.htm b/docs/html/b63dbea1-f9be-1fa1-df74-ecdd281c06c7.htm
deleted file mode 100644
index 765943981..000000000
--- a/docs/html/b63dbea1-f9be-1fa1-df74-ecdd281c06c7.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.Where Method (IQueryable, LambdaExpression) DynamicQueryableExtensions Where Method (IQueryable, LambdaExpression)
- Filters a sequence of values based on a predicate.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/b6438175-d119-7f45-11f3-c98fd564f01c.htm b/docs/html/b6438175-d119-7f45-11f3-c98fd564f01c.htm
deleted file mode 100644
index c850f7d8e..000000000
--- a/docs/html/b6438175-d119-7f45-11f3-c98fd564f01c.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.OfType Method (IQueryable, Type) DynamicQueryableExtensions OfType Method (IQueryable, Type)
- Filters the elements of an
IQueryable based on a specified type.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/b69b4248-5dce-88d7-5ea3-07e4da6647db.htm b/docs/html/b69b4248-5dce-88d7-5ea3-07e4da6647db.htm
deleted file mode 100644
index 24441375a..000000000
--- a/docs/html/b69b4248-5dce-88d7-5ea3-07e4da6647db.htm
+++ /dev/null
@@ -1,14 +0,0 @@
-
DynamicQueryableExtensions.ThenBy Method (IOrderedQueryable, String, Object[]) DynamicQueryableExtensions ThenBy Method (IOrderedQueryable, String, Object )
- Performs a subsequent ordering of the elements in a sequence in ascending order according to a key.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IOrderedQueryable ThenBy (
- this IOrderedQueryable source ,
- string ordering ,
- params Object [] args
-)Parameters source Type: System.Linq IOrderedQueryable A sequence of values to order. ordering Type: System String An expression string to indicate values to order by. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IOrderedQueryable A
IQueryable whose elements are sorted according to the specified
ordering .
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IOrderedQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Examplesvar result = queryable.OrderBy("LastName" );
-var resultSingle = result.OrderBy("NumberProperty" );
-var resultSingleDescending = result.OrderBy("NumberProperty DESC" );
-var resultMultiple = result.OrderBy("NumberProperty, StringProperty DESC" ); See Also
\ No newline at end of file
diff --git a/docs/html/b77a8f50-8987-c0d1-3b6f-4bd016c87751.htm b/docs/html/b77a8f50-8987-c0d1-3b6f-4bd016c87751.htm
deleted file mode 100644
index 5d510bb3a..000000000
--- a/docs/html/b77a8f50-8987-c0d1-3b6f-4bd016c87751.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
ParsingConfig.QueryableAnalyzer Property ParsingConfig QueryableAnalyzer Property
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic IQueryableAnalyzer QueryableAnalyzer { get ; set ; }Property Value Type:
IQueryableAnalyzer See Also
\ No newline at end of file
diff --git a/docs/html/b7ca9bf2-84db-0204-2362-61e9d90c9abe.htm b/docs/html/b7ca9bf2-84db-0204-2362-61e9d90c9abe.htm
deleted file mode 100644
index f561da762..000000000
--- a/docs/html/b7ca9bf2-84db-0204-2362-61e9d90c9abe.htm
+++ /dev/null
@@ -1,23 +0,0 @@
-
DynamicQueryableExtensions.SelectMany Method (IQueryable, ParsingConfig, String, String, String, String, Object[], Object[]) DynamicQueryableExtensions SelectMany Method (IQueryable, ParsingConfig, String, String, String, String, Object , Object )
- Projects each element of a sequence to an
IQueryable
- and invokes a result selector function on each element therein. The resulting
- values from each intermediate sequence are combined into a single, one-dimensional
- sequence and returned.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable SelectMany (
- this IQueryable source ,
- ParsingConfig config ,
- string collectionSelector ,
- string resultSelector ,
- string collectionParameterName ,
- string resultParameterName ,
- Object [] collectionSelectorArgs = null ,
- params Object [] resultSelectorArgs
-)Parameters source Type: System.Linq IQueryable A sequence of values to project. config Type: System.Linq.Dynamic.Core ParsingConfig The ParsingConfig . collectionSelector Type: System String A projection function to apply to each element of the input sequence. resultSelector Type: System String A projection function to apply to each element of each intermediate sequence. collectionParameterName Type: System String The name from collectionParameter to use. Default is x. resultParameterName Type: System String The name from resultParameterName to use. Default is y. collectionSelectorArgs (Optional)Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. resultSelectorArgs Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable
- An
IQueryable whose elements are the result of invoking the one-to-many
- projection function
collectionSelector on each element of source and then mapping
- each of those sequence elements and their corresponding source element to a result element.
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Examples See Also
\ No newline at end of file
diff --git a/docs/html/bba4962d-c071-c465-5c4e-75754a7ad9bb.htm b/docs/html/bba4962d-c071-c465-5c4e-75754a7ad9bb.htm
deleted file mode 100644
index 83be4fba3..000000000
--- a/docs/html/bba4962d-c071-c465-5c4e-75754a7ad9bb.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
IGrouping`2 Interface Represents a collection of objects that have a common key.
-
Namespace:
-
System.Linq
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic interface IGrouping`2 See Also
\ No newline at end of file
diff --git a/docs/html/bd57e5da-91f3-3386-eb56-0945ca4e6df8.htm b/docs/html/bd57e5da-91f3-3386-eb56-0945ca4e6df8.htm
deleted file mode 100644
index c9554241b..000000000
--- a/docs/html/bd57e5da-91f3-3386-eb56-0945ca4e6df8.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.FirstAsync Method EntityFrameworkDynamicQueryableExtensions FirstAsync Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/bd69785a-e783-d570-a543-44cbdd263af5.htm b/docs/html/bd69785a-e783-d570-a543-44cbdd263af5.htm
deleted file mode 100644
index 015836b14..000000000
--- a/docs/html/bd69785a-e783-d570-a543-44cbdd263af5.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
ParsingConfig.ExpressionPromoter Property ParsingConfig ExpressionPromoter Property
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic IExpressionPromoter ExpressionPromoter { get ; set ; }Property Value Type:
IExpressionPromoter See Also
\ No newline at end of file
diff --git a/docs/html/bf5be831-4e5d-7898-e7fb-18dafc1d519b.htm b/docs/html/bf5be831-4e5d-7898-e7fb-18dafc1d519b.htm
deleted file mode 100644
index ba8dca445..000000000
--- a/docs/html/bf5be831-4e5d-7898-e7fb-18dafc1d519b.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.Any Method (IQueryable, LambdaExpression) DynamicQueryableExtensions Any Method (IQueryable, LambdaExpression)
- Determines whether a sequence contains any elements.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/c023cc71-ddee-1216-72bf-325a937c84f5.htm b/docs/html/c023cc71-ddee-1216-72bf-325a937c84f5.htm
deleted file mode 100644
index d3f2fa5f5..000000000
--- a/docs/html/c023cc71-ddee-1216-72bf-325a937c84f5.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.AnyAsync Method (IQueryable, CancellationToken) EntityFrameworkDynamicQueryableExtensions AnyAsync Method (IQueryable, CancellationToken)
- Asynchronously determines whether a sequence contains any elements.
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntax Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/c163ce6b-21e1-df62-207f-49053fd04c27.htm b/docs/html/c163ce6b-21e1-df62-207f-49053fd04c27.htm
deleted file mode 100644
index ea5d97497..000000000
--- a/docs/html/c163ce6b-21e1-df62-207f-49053fd04c27.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
IExpressionPromoter Interface IExpressionPromoter Interface
- Expression promoter is used to promote object or value types
- to their destination type when an automatic promotion is available
- such as: int to int?
-
-
Namespace:
-
System.Linq.Dynamic.Core.Parser
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic interface IExpressionPromoter The IExpressionPromoter type exposes the following members.
Methods
-
- Name Description Promote
- Promote an expression
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/c1be0fc8-f6e4-6bfe-4da7-329414bf8359.htm b/docs/html/c1be0fc8-f6e4-6bfe-4da7-329414bf8359.htm
deleted file mode 100644
index 8b283e351..000000000
--- a/docs/html/c1be0fc8-f6e4-6bfe-4da7-329414bf8359.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicEnumerableAsyncExtensions Methods DynamicEnumerableAsyncExtensions Methods
Methods See Also
\ No newline at end of file
diff --git a/docs/html/c2d6f5cb-9277-d7c3-4e32-abfdd20b6300.htm b/docs/html/c2d6f5cb-9277-d7c3-4e32-abfdd20b6300.htm
deleted file mode 100644
index e0458c480..000000000
--- a/docs/html/c2d6f5cb-9277-d7c3-4e32-abfdd20b6300.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
ParsingConfig.DefaultEFCore21 Property ParsingConfig DefaultEFCore21 Property
- Default ParsingConfig for EntityFramework Core 2.1 and higher
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static ParsingConfig DefaultEFCore21 { get ; }Property Value Type:
ParsingConfig See Also
\ No newline at end of file
diff --git a/docs/html/c2dce7cc-70cd-a723-4b0c-60aa5478cade.htm b/docs/html/c2dce7cc-70cd-a723-4b0c-60aa5478cade.htm
deleted file mode 100644
index 976bfb1f1..000000000
--- a/docs/html/c2dce7cc-70cd-a723-4b0c-60aa5478cade.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.LastAsync Method EntityFrameworkDynamicQueryableExtensions LastAsync Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/c32c300b-e2da-0f93-2861-7786dfb3bfdf.htm b/docs/html/c32c300b-e2da-0f93-2861-7786dfb3bfdf.htm
deleted file mode 100644
index f74bb13bc..000000000
--- a/docs/html/c32c300b-e2da-0f93-2861-7786dfb3bfdf.htm
+++ /dev/null
@@ -1,14 +0,0 @@
-
DynamicQueryableExtensions.GroupBy Method (IQueryable, ParsingConfig, String, Object[]) DynamicQueryableExtensions GroupBy Method (IQueryable, ParsingConfig, String, Object )
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax Examplesvar groupResult1 = queryable.GroupBy("NumberPropertyAsKey" );
-var groupResult2 = queryable.GroupBy("new (NumberPropertyAsKey, StringPropertyAsKey)" ); See Also
\ No newline at end of file
diff --git a/docs/html/c4843660-11b6-56d9-f85b-60bc13755db4.htm b/docs/html/c4843660-11b6-56d9-f85b-60bc13755db4.htm
deleted file mode 100644
index 3e969b9fc..000000000
--- a/docs/html/c4843660-11b6-56d9-f85b-60bc13755db4.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicEnumerableExtensions.ToDynamicArray Method (IEnumerable, Type) DynamicEnumerableExtensions ToDynamicArray Method (IEnumerable, Type)
- Creates an array of dynamic objects from a
IEnumerable .
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/c49a2fb5-2fd6-896d-d9b9-6872b1bc7116.htm b/docs/html/c49a2fb5-2fd6-896d-d9b9-6872b1bc7116.htm
deleted file mode 100644
index 9b8033fc5..000000000
--- a/docs/html/c49a2fb5-2fd6-896d-d9b9-6872b1bc7116.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.OrderBy(TSource) Method (Void, TSource, IQueryable) DynamicQueryableExtensions OrderByTSource Method (Void, TSource , IQueryable)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.OrderBy``1(System.Void,``0,System.Linq.IQueryable`1)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IOrderedQueryable OrderBy <TSource>(
- this void source ,
- TSource ordering ,
- params IQueryable args
-)
-Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.OrderBy``1(System.Void,``0,System.Linq.IQueryable`1)"]
ordering Type: TSource [Missing <param name="ordering"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.OrderBy``1(System.Void,``0,System.Linq.IQueryable`1)"]
args Type: System.Linq IQueryable T [Missing <param name="args"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.OrderBy``1(System.Void,``0,System.Linq.IQueryable`1)"]
Type Parameters TSource [Missing <typeparam name="TSource"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.OrderBy``1(System.Void,``0,System.Linq.IQueryable`1)"]
Return Value Type:
IOrderedQueryable T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.OrderBy``1(System.Void,``0,System.Linq.IQueryable`1)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/c49f9809-5da8-58fb-8339-86c7093be0a8.htm b/docs/html/c49f9809-5da8-58fb-8339-86c7093be0a8.htm
deleted file mode 100644
index 82024d9f4..000000000
--- a/docs/html/c49f9809-5da8-58fb-8339-86c7093be0a8.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.Count Method DynamicQueryableExtensions Count Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/c6055bf8-59c5-fbca-01b7-3f5c47414829.htm b/docs/html/c6055bf8-59c5-fbca-01b7-3f5c47414829.htm
deleted file mode 100644
index 0f5a48f59..000000000
--- a/docs/html/c6055bf8-59c5-fbca-01b7-3f5c47414829.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
IQueryableAnalyzer Methods IQueryableAnalyzer Methods
The IQueryableAnalyzer type exposes the following members.
Methods
-
- Name Description SupportsLinqToObjects
- Determines whether the specified query (and provider) supports LinqToObjects.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/c8295914-1540-2db7-c32e-64bc03dc0be6.htm b/docs/html/c8295914-1540-2db7-c32e-64bc03dc0be6.htm
deleted file mode 100644
index e7c40ff58..000000000
--- a/docs/html/c8295914-1540-2db7-c32e-64bc03dc0be6.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.SelectMany Method (IQueryable, String, Object[]) DynamicQueryableExtensions SelectMany Method (IQueryable, String, Object )
- Projects each element of a sequence to an
IQueryable and combines the resulting sequences into one sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable SelectMany (
- this IQueryable source ,
- string selector ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable A sequence of values to project. selector Type: System String A projection string expression to apply to each element. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable An
IQueryable whose elements are the result of invoking a one-to-many projection function on each element of the input sequence.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Examplesvar roles = users.SelectMany("Roles" ); See Also
\ No newline at end of file
diff --git a/docs/html/c99307f1-492e-26c3-68e7-2ffa71ee4598.htm b/docs/html/c99307f1-492e-26c3-68e7-2ffa71ee4598.htm
deleted file mode 100644
index 6e2e31a20..000000000
--- a/docs/html/c99307f1-492e-26c3-68e7-2ffa71ee4598.htm
+++ /dev/null
@@ -1,14 +0,0 @@
-
DynamicQueryableExtensions.Any Method (IQueryable, String, Object[]) DynamicQueryableExtensions Any Method (IQueryable, String, Object )
- Determines whether a sequence contains any elements.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static bool Any (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable A sequence to check for being empty. predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Boolean true if the source sequence contains any elements; otherwise, false.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
ExamplesIQueryable queryable = employees.AsQueryable();
-var result1 = queryable.Any("Income > 50" );
-var result2 = queryable.Any("Income > @0" , 50 );
-var result3 = queryable.Select("Roles.Any()" ); See Also
\ No newline at end of file
diff --git a/docs/html/ca3a380a-0fe3-cea2-0107-f7ca1d5bd9fe.htm b/docs/html/ca3a380a-0fe3-cea2-0107-f7ca1d5bd9fe.htm
deleted file mode 100644
index 01af10a57..000000000
--- a/docs/html/ca3a380a-0fe3-cea2-0107-f7ca1d5bd9fe.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.FirstOrDefault Method DynamicQueryableExtensions FirstOrDefault Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/ca4fe1f4-1f13-01d5-a6b7-3a0b3fdd0203.htm b/docs/html/ca4fe1f4-1f13-01d5-a6b7-3a0b3fdd0203.htm
deleted file mode 100644
index efd9251ef..000000000
--- a/docs/html/ca4fe1f4-1f13-01d5-a6b7-3a0b3fdd0203.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
DefaultQueryableAnalyzer Methods DefaultQueryableAnalyzer Methods
The DefaultQueryableAnalyzer type exposes the following members.
Methods
-
- Name Description Equals Determines whether the specified object is equal to the current object.
(Inherited from Object .)Finalize Allows an object to try to free resources and perform other cleanup operations before it is reclaimed by garbage collection.
(Inherited from Object .)GetHashCode Serves as the default hash function.
(Inherited from Object .)GetType Gets the
Type of the current instance.
(Inherited from Object .)MemberwiseClone Creates a shallow copy of the current
Object .
(Inherited from Object .)SupportsLinqToObjects
- Determines whether the specified query (and provider) supports LinqToObjects.
-
ToString Returns a string that represents the current object.
(Inherited from Object .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/cae4f816-bb4a-f03a-a557-c7ad09b5a719.htm b/docs/html/cae4f816-bb4a-f03a-a557-c7ad09b5a719.htm
deleted file mode 100644
index 190dda9ca..000000000
--- a/docs/html/cae4f816-bb4a-f03a-a557-c7ad09b5a719.htm
+++ /dev/null
@@ -1,8 +0,0 @@
-
DynamicEnumerableAsyncExtensions.ToDynamicListAsync Method (Void, Object) DynamicEnumerableAsyncExtensions ToDynamicListAsync Method (Void, Object)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableAsyncExtensions.ToDynamicListAsync(System.Void,System.Object)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static Task <List > ToDynamicListAsync (
- this void source ,
- Object type
-)Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableAsyncExtensions.ToDynamicListAsync(System.Void,System.Object)"]
type Type: System Object [Missing <param name="type"/> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableAsyncExtensions.ToDynamicListAsync(System.Void,System.Object)"]
Return Value Type:
Task List T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableAsyncExtensions.ToDynamicListAsync(System.Void,System.Object)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/cb8166eb-490f-ac7a-3759-9bf25cd3c1e3.htm b/docs/html/cb8166eb-490f-ac7a-3759-9bf25cd3c1e3.htm
deleted file mode 100644
index 225e3d810..000000000
--- a/docs/html/cb8166eb-490f-ac7a-3759-9bf25cd3c1e3.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
ParseException Methods The ParseException type exposes the following members.
Methods See Also
\ No newline at end of file
diff --git a/docs/html/cb9087d9-5f3b-378b-3640-6e3880c4ffa7.htm b/docs/html/cb9087d9-5f3b-378b-3640-6e3880c4ffa7.htm
deleted file mode 100644
index 0e499a501..000000000
--- a/docs/html/cb9087d9-5f3b-378b-3640-6e3880c4ffa7.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicExpressionParser.ParseLambda Method (Type, String, Object[]) DynamicExpressionParser ParseLambda Method (Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static LambdaExpression ParseLambda (
- Type resultType ,
- string expression ,
- params Object [] values
-)Parameters resultType Type: System Type Type of the result. If not specified, it will be generated dynamically. expression Type: System String The expression. values Type: System Object An object array that contains zero or more objects which are used as replacement values. Return Value Type:
LambdaExpression The generated
LambdaExpression See Also
\ No newline at end of file
diff --git a/docs/html/cc0ffba1-1feb-5351-ec86-dd9d01bb025c.htm b/docs/html/cc0ffba1-1feb-5351-ec86-dd9d01bb025c.htm
deleted file mode 100644
index b43359af0..000000000
--- a/docs/html/cc0ffba1-1feb-5351-ec86-dd9d01bb025c.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.LastOrDefaultAsync Method EntityFrameworkDynamicQueryableExtensions LastOrDefaultAsync Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/cde853fb-e83a-0911-6f76-7f04e385b62c.htm b/docs/html/cde853fb-e83a-0911-6f76-7f04e385b62c.htm
deleted file mode 100644
index ec819a559..000000000
--- a/docs/html/cde853fb-e83a-0911-6f76-7f04e385b62c.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicEnumerableExtensions.ToDynamicArray Method DynamicEnumerableExtensions ToDynamicArray Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/ce1cbbfd-3590-be85-de65-a92190be3d28.htm b/docs/html/ce1cbbfd-3590-be85-de65-a92190be3d28.htm
deleted file mode 100644
index 2776025ba..000000000
--- a/docs/html/ce1cbbfd-3590-be85-de65-a92190be3d28.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
PagedResult.PageSize Property PagedResult PageSize Property
- Gets or sets the size of the page.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic int PageSize { get ; set ; }Property Value Type:
Int32
- The size of the page.
-
See Also
\ No newline at end of file
diff --git a/docs/html/ce214401-dbe6-51b3-6eff-7123a7c778ad.htm b/docs/html/ce214401-dbe6-51b3-6eff-7123a7c778ad.htm
deleted file mode 100644
index 784c9fcff..000000000
--- a/docs/html/ce214401-dbe6-51b3-6eff-7123a7c778ad.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.FirstAsync Method (IQueryable, CancellationToken) EntityFrameworkDynamicQueryableExtensions FirstAsync Method (IQueryable, CancellationToken)
- Asynchronously returns the first element of a sequence.
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntax Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/ceadcc45-8df3-c8dd-c45c-6ea1f855fb15.htm b/docs/html/ceadcc45-8df3-c8dd-c45c-6ea1f855fb15.htm
deleted file mode 100644
index 6c2630912..000000000
--- a/docs/html/ceadcc45-8df3-c8dd-c45c-6ea1f855fb15.htm
+++ /dev/null
@@ -1,23 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.CountAsync Method (IQueryable, CancellationToken, String, Object[]) EntityFrameworkDynamicQueryableExtensions CountAsync Method (IQueryable, CancellationToken, String, Object )
- Asynchronously returns the number of elements in a sequence that satisfy a condition.
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <int > CountAsync (
- this IQueryable source ,
- CancellationToken cancellationToken ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable that contains the elements to be counted.
- cancellationToken Type: System.Threading CancellationToken
- A CancellationToken to observe while waiting for the task to complete.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Int32
- A task that represents the asynchronous operation.
- The task result contains the number of elements in the sequence that satisfy the condition in the predicate
- function.
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/cf555f7f-d2b6-dd9e-7b18-74299672fc73.htm b/docs/html/cf555f7f-d2b6-dd9e-7b18-74299672fc73.htm
deleted file mode 100644
index c89b1aa7f..000000000
--- a/docs/html/cf555f7f-d2b6-dd9e-7b18-74299672fc73.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.First Method (IQueryable, LambdaExpression) DynamicQueryableExtensions First Method (IQueryable, LambdaExpression)
- Returns the first element of a sequence that satisfies a specified condition.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/d0a8c071-ea89-3dc6-2510-1bde7cdff0f6.htm b/docs/html/d0a8c071-ea89-3dc6-2510-1bde7cdff0f6.htm
deleted file mode 100644
index 447ef32f1..000000000
--- a/docs/html/d0a8c071-ea89-3dc6-2510-1bde7cdff0f6.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicEnumerableExtensions.ToDynamicArray(T) Method (IEnumerable) DynamicEnumerableExtensions ToDynamicArrayT Method (IEnumerable)
- Creates an array of dynamic objects from a
IEnumerable .
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/d0aca88b-6e17-8548-6c69-b1494762f3df.htm b/docs/html/d0aca88b-6e17-8548-6c69-b1494762f3df.htm
deleted file mode 100644
index 2023ae429..000000000
--- a/docs/html/d0aca88b-6e17-8548-6c69-b1494762f3df.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.First Method (IQueryable, String, Object[]) DynamicQueryableExtensions First Method (IQueryable, String, Object )
- Returns the first element of a sequence that satisfies a specified condition.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static Object First (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable The IQueryable to return the first element of. predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Object The first element in source that passes the test in predicate.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/d0fc02c8-c1bf-7620-0787-66e6a608753c.htm b/docs/html/d0fc02c8-c1bf-7620-0787-66e6a608753c.htm
deleted file mode 100644
index 3fbef9757..000000000
--- a/docs/html/d0fc02c8-c1bf-7620-0787-66e6a608753c.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.CountAsync Method (IQueryable, CancellationToken) EntityFrameworkDynamicQueryableExtensions CountAsync Method (IQueryable, CancellationToken)
- Asynchronously returns the number of elements in a sequence.
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntax Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/d129e142-6c8c-79c7-468c-e3783d1d977f.htm b/docs/html/d129e142-6c8c-79c7-468c-e3783d1d977f.htm
deleted file mode 100644
index 749e0e420..000000000
--- a/docs/html/d129e142-6c8c-79c7-468c-e3783d1d977f.htm
+++ /dev/null
@@ -1,23 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.FirstAsync Method (IQueryable, CancellationToken, String, Object[]) EntityFrameworkDynamicQueryableExtensions FirstAsync Method (IQueryable, CancellationToken, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition.
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > FirstAsync (
- this IQueryable source ,
- CancellationToken cancellationToken ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the first element of.
- cancellationToken Type: System.Threading CancellationToken
- A CancellationToken to observe while waiting for the task to complete.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation.
- The task result contains the first element in
source that passes the test in
-
predicate .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/d3442954-d871-8253-7c6c-f8f01a7d3119.htm b/docs/html/d3442954-d871-8253-7c6c-f8f01a7d3119.htm
deleted file mode 100644
index 6ab9ae072..000000000
--- a/docs/html/d3442954-d871-8253-7c6c-f8f01a7d3119.htm
+++ /dev/null
@@ -1,22 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.LastOrDefaultAsync Method (IQueryable, String, Object[]) EntityFrameworkDynamicQueryableExtensions LastOrDefaultAsync Method (IQueryable, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition
- or a default value if no such element is found. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > LastOrDefaultAsync (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the last element of.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation.
- The task result contains
default if
source
- is empty or if no element passes the test specified by
predicate ; otherwise, the last
- element in
source that passes the test specified by
predicate .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/d3f866e9-1b22-2c6d-0c5a-1cd29ab09730.htm b/docs/html/d3f866e9-1b22-2c6d-0c5a-1cd29ab09730.htm
deleted file mode 100644
index 7c11d04d8..000000000
--- a/docs/html/d3f866e9-1b22-2c6d-0c5a-1cd29ab09730.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicClass.GetDynamicMemberNames Method DynamicClass GetDynamicMemberNames Method
- Returns the enumeration of all dynamic member names.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic virtual IEnumerable <string > GetDynamicMemberNames ()Return Value Type:
IEnumerable String
- A sequence that contains dynamic member names.
-
See Also
\ No newline at end of file
diff --git a/docs/html/d484c034-9f69-29ca-2643-5b8b0c31b76f.htm b/docs/html/d484c034-9f69-29ca-2643-5b8b0c31b76f.htm
deleted file mode 100644
index f4e8478e8..000000000
--- a/docs/html/d484c034-9f69-29ca-2643-5b8b0c31b76f.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.Take Method DynamicQueryableExtensions Take Method
- Returns a specified number of contiguous elements from the start of a sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/d6a52ff1-1fd8-e1b3-b372-61d314a78d5e.htm b/docs/html/d6a52ff1-1fd8-e1b3-b372-61d314a78d5e.htm
deleted file mode 100644
index 480c55e06..000000000
--- a/docs/html/d6a52ff1-1fd8-e1b3-b372-61d314a78d5e.htm
+++ /dev/null
@@ -1,23 +0,0 @@
-
PagedResult Class
- PagedResult
-
Inheritance Hierarchy
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
SyntaxThe PagedResult type exposes the following members.
Constructors
-
- Name Description PagedResult Initializes a new instance of the PagedResult class
Top Properties
-
- Name Description CurrentPage
- Gets or sets the current page.
-
PageCount
- Gets or sets the page count.
-
PageSize
- Gets or sets the size of the page.
-
Queryable
- Gets or sets the queryable.
-
RowCount
- Gets or sets the row count.
-
Top Methods
-
- Name Description Equals Determines whether the specified object is equal to the current object.
(Inherited from Object .)Finalize Allows an object to try to free resources and perform other cleanup operations before it is reclaimed by garbage collection.
(Inherited from Object .)GetHashCode Serves as the default hash function.
(Inherited from Object .)GetType Gets the
Type of the current instance.
(Inherited from Object .)MemberwiseClone Creates a shallow copy of the current
Object .
(Inherited from Object .)ToString Returns a string that represents the current object.
(Inherited from Object .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/d6e24413-512d-f9d2-b470-e7b497242961.htm b/docs/html/d6e24413-512d-f9d2-b470-e7b497242961.htm
deleted file mode 100644
index 3343a917f..000000000
--- a/docs/html/d6e24413-512d-f9d2-b470-e7b497242961.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
DynamicLinqTypeAttribute Constructor DynamicLinqTypeAttribute Constructor
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic DynamicLinqTypeAttribute () See Also
\ No newline at end of file
diff --git a/docs/html/d6e97f9c-e7b8-dfff-6695-b293bac9f296.htm b/docs/html/d6e97f9c-e7b8-dfff-6695-b293bac9f296.htm
deleted file mode 100644
index 0d446a8ea..000000000
--- a/docs/html/d6e97f9c-e7b8-dfff-6695-b293bac9f296.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicClass.SetDynamicPropertyValue Method (String, Object) DynamicClass SetDynamicPropertyValue Method (String, Object)
- Sets the dynamic property value by name.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic void SetDynamicPropertyValue (
- string propertyName ,
- Object value
-)Parameters propertyName Type: System String Name of the property. value Type: System Object The value. See Also
\ No newline at end of file
diff --git a/docs/html/d74490d2-17c1-ac5f-caa3-1e882d0a2746.htm b/docs/html/d74490d2-17c1-ac5f-caa3-1e882d0a2746.htm
deleted file mode 100644
index a1ccffb85..000000000
--- a/docs/html/d74490d2-17c1-ac5f-caa3-1e882d0a2746.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.Single Method (IQueryable, LambdaExpression) DynamicQueryableExtensions Single Method (IQueryable, LambdaExpression)
- Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there
- is not exactly one element in the sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/d870c15e-1241-5d9e-9eaa-01c04b808e69.htm b/docs/html/d870c15e-1241-5d9e-9eaa-01c04b808e69.htm
deleted file mode 100644
index 351212972..000000000
--- a/docs/html/d870c15e-1241-5d9e-9eaa-01c04b808e69.htm
+++ /dev/null
@@ -1,15 +0,0 @@
-
DynamicQueryableExtensions.Join Method (IQueryable, ParsingConfig, IEnumerable, String, String, String, Object[]) DynamicQueryableExtensions Join Method (IQueryable, ParsingConfig, IEnumerable, String, String, String, Object )
- Correlates the elements of two sequences based on matching keys. The default equality comparer is used to compare keys.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable Join (
- this IQueryable outer ,
- ParsingConfig config ,
- IEnumerable inner ,
- string outerKeySelector ,
- string innerKeySelector ,
- string resultSelector ,
- params Object [] args
-)Parameters outer Type: System.Linq IQueryable The first sequence to join. config Type: System.Linq.Dynamic.Core ParsingConfig The ParsingConfig . inner Type: System.Collections IEnumerable The sequence to join to the first sequence. outerKeySelector Type: System String A dynamic function to extract the join key from each element of the first sequence. innerKeySelector Type: System String A dynamic function to extract the join key from each element of the second sequence. resultSelector Type: System String A dynamic function to create a result element from two matching elements. args Type: System Object An object array that contains zero or more objects to insert into the predicates as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable An
IQueryable obtained by performing an inner join on two sequences.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/d8a7dbfa-e517-7494-426e-d054bd0b1181.htm b/docs/html/d8a7dbfa-e517-7494-426e-d054bd0b1181.htm
deleted file mode 100644
index 48263bf75..000000000
--- a/docs/html/d8a7dbfa-e517-7494-426e-d054bd0b1181.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.Cast Method (IQueryable, String) DynamicQueryableExtensions Cast Method (IQueryable, String)
- Converts the elements of an
IQueryable to the specified type.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/da78abc2-279f-beff-343e-6802a2d6d71d.htm b/docs/html/da78abc2-279f-beff-343e-6802a2d6d71d.htm
deleted file mode 100644
index 82d0d67d5..000000000
--- a/docs/html/da78abc2-279f-beff-343e-6802a2d6d71d.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicEnumerableExtensions.ToDynamicArray Method (IEnumerable) DynamicEnumerableExtensions ToDynamicArray Method (IEnumerable)
- Creates an array of dynamic objects from a
IEnumerable .
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/dd2d36b4-81cd-71fe-876e-8242dcba6590.htm b/docs/html/dd2d36b4-81cd-71fe-876e-8242dcba6590.htm
deleted file mode 100644
index cf00ed5f4..000000000
--- a/docs/html/dd2d36b4-81cd-71fe-876e-8242dcba6590.htm
+++ /dev/null
@@ -1,23 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.CountAsync Method (IQueryable, CancellationToken, String, Object[]) EntityFrameworkDynamicQueryableExtensions CountAsync Method (IQueryable, CancellationToken, String, Object )
- Asynchronously returns the number of elements in a sequence that satisfy a condition.
-
-
Namespace:
-
EntityFramework.DynamicLinq
-
Assembly:
- EntityFramework.DynamicLinq (in EntityFramework.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <int > CountAsync (
- this IQueryable source ,
- CancellationToken cancellationToken ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable that contains the elements to be counted.
- cancellationToken Type: System.Threading CancellationToken
- A CancellationToken to observe while waiting for the task to complete.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Int32
- A task that represents the asynchronous operation.
- The task result contains the number of elements in the sequence that satisfy the condition in the predicate
- function.
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/dde5b439-ba6c-42bd-a39d-e163271019dd.htm b/docs/html/dde5b439-ba6c-42bd-a39d-e163271019dd.htm
deleted file mode 100644
index 0e4f6ad94..000000000
--- a/docs/html/dde5b439-ba6c-42bd-a39d-e163271019dd.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.LastOrDefaultAsync Method EntityFrameworkDynamicQueryableExtensions LastOrDefaultAsync Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/de13f53d-3367-2ef2-0efd-37dba00f10d1.htm b/docs/html/de13f53d-3367-2ef2-0efd-37dba00f10d1.htm
deleted file mode 100644
index 9d40bbb30..000000000
--- a/docs/html/de13f53d-3367-2ef2-0efd-37dba00f10d1.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
GroupResult.Key Property
- The key value of the group.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic Object Key { get ; }Property Value Type:
Object See Also
\ No newline at end of file
diff --git a/docs/html/de47654c-7ae4-9302-3061-ea6307706cb8.htm b/docs/html/de47654c-7ae4-9302-3061-ea6307706cb8.htm
deleted file mode 100644
index b05003cf7..000000000
--- a/docs/html/de47654c-7ae4-9302-3061-ea6307706cb8.htm
+++ /dev/null
@@ -1,46 +0,0 @@
-
System.Linq.Dynamic.Core Namespace System.Linq.Dynamic.Core Namespace
This is a .NET Core port of the the Microsoft assembly for the .Net 4.0 Dynamic language functionality.
Classes
-
- Class Description DefaultQueryableAnalyzer
- Default implementation.
-
DynamicClass
- Provides a base class for dynamic objects.
-
- In addition to the methods defined here, the following items are added using reflection:
- - default constructor
- - constructor with all the properties as parameters (if not linq-to-entities)
- - all properties (also with getter and setters)
- - ToString() method
- - Equals() method
- - GetHashCode() method
-
DynamicClassFactory DynamicEnumerableAsyncExtensions DynamicEnumerableExtensions DynamicExpressionParser
- Helper class to convert an expression into an LambdaExpression
-
DynamicProperty
- DynamicProperty
-
DynamicQueryableExtensions
- Provides a set of static (Shared in Visual Basic) methods for querying data structures that implement
IQueryable .
- It allows dynamic string based querying. Very handy when, at compile time, you don't know the type of queries that will be generated,
- or when downstream components only return column names to sort and filter by.
-
ExtensibilityPoint
- Extensibility point: If you want to modify expanded queries before executing them
- set your own functionality to override empty QueryOptimizer
-
GroupResult PagedResult
- PagedResult
-
PagedResult TSource
- PagedResult{TSource}
-
ParsingConfig
- Configuration class for System.Linq.Dynamic.Core.
-
Interfaces
-
- Interface Description IAssemblyHelper
- IAssemblyHelper interface which is used to retrieve assemblies that have been loaded into the execution context of this application domain.
-
IQueryableAnalyzer
- Interface for QueryableAnalyzer.
-
\ No newline at end of file
diff --git a/docs/html/de483a9a-bbaa-c976-2d1e-c568f8a0f6f4.htm b/docs/html/de483a9a-bbaa-c976-2d1e-c568f8a0f6f4.htm
deleted file mode 100644
index 89a11102a..000000000
--- a/docs/html/de483a9a-bbaa-c976-2d1e-c568f8a0f6f4.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicClass.GetDynamicPropertyValue(T) Method (String) DynamicClass GetDynamicPropertyValueT Method (String)
- Gets the dynamic property by name.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic T GetDynamicPropertyValue <T>(
- string propertyName
-)
-Parameters propertyName Type: System String Name of the property. Type Parameters T The type. Return Value Type:
T T
See Also
\ No newline at end of file
diff --git a/docs/html/dfb940e9-b6d9-1ad9-d321-1037ba6f5647.htm b/docs/html/dfb940e9-b6d9-1ad9-d321-1037ba6f5647.htm
deleted file mode 100644
index b1de56db3..000000000
--- a/docs/html/dfb940e9-b6d9-1ad9-d321-1037ba6f5647.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicQueryableExtensions.SingleOrDefault Method (IQueryable, ParsingConfig, String, Object[]) DynamicQueryableExtensions SingleOrDefault Method (IQueryable, ParsingConfig, String, Object )
- Returns the only element of a sequence that satisfies a specified condition or a default value if the sequence
- is empty; and throws an exception if there is not exactly one element in the sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/e050a329-ded5-b6ad-bee5-bdcb2a97c5ee.htm b/docs/html/e050a329-ded5-b6ad-bee5-bdcb2a97c5ee.htm
deleted file mode 100644
index 2f7b8c838..000000000
--- a/docs/html/e050a329-ded5-b6ad-bee5-bdcb2a97c5ee.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
DynamicQueryableExtensions.Page Method DynamicQueryableExtensions Page Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/e0821bd0-c03e-990b-0ef1-c2637f587df7.htm b/docs/html/e0821bd0-c03e-990b-0ef1-c2637f587df7.htm
deleted file mode 100644
index cecd5a09a..000000000
--- a/docs/html/e0821bd0-c03e-990b-0ef1-c2637f587df7.htm
+++ /dev/null
@@ -1,14 +0,0 @@
-
DynamicQueryableExtensions.TakeWhile Method (IQueryable, ParsingConfig, String, Object[]) DynamicQueryableExtensions TakeWhile Method (IQueryable, ParsingConfig, String, Object )
- Returns elements from a sequence as long as a specified condition is true.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable TakeWhile (
- this IQueryable source ,
- ParsingConfig config ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable A sequence to check for being empty. config Type: System.Linq.Dynamic.Core ParsingConfig The ParsingConfig . predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
IQueryable An
IQueryable that contains elements from the input sequence occurring before the element at which the test specified by predicate no longer passes.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
ExamplesIQueryable queryable = employees.AsQueryable();
-var result1 = queryable.TakeWhile("Income > 50" );
-var result2 = queryable.TakeWhile("Income > @0" , 50 ); See Also
\ No newline at end of file
diff --git a/docs/html/e0ca6de4-6275-a440-a2e6-673c389eb912.htm b/docs/html/e0ca6de4-6275-a440-a2e6-673c389eb912.htm
deleted file mode 100644
index ddc1e12b9..000000000
--- a/docs/html/e0ca6de4-6275-a440-a2e6-673c389eb912.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicQueryableExtensions.DefaultIfEmpty Method (IQueryable) DynamicQueryableExtensions DefaultIfEmpty Method (IQueryable)
- Returns the elements of the specified sequence or the type parameter's default value in a singleton collection if the sequence is empty.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax ExamplesIQueryable queryable = employees.DefaultIfEmpty(); See Also
\ No newline at end of file
diff --git a/docs/html/e2269313-2cf3-821c-7384-180bde38df88.htm b/docs/html/e2269313-2cf3-821c-7384-180bde38df88.htm
deleted file mode 100644
index 458a50b59..000000000
--- a/docs/html/e2269313-2cf3-821c-7384-180bde38df88.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.AnyAsync Method (IQueryable, String, Object[]) EntityFrameworkDynamicQueryableExtensions AnyAsync Method (IQueryable, String, Object )
- Asynchronously determines whether any element of a sequence satisfies a condition.
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <bool > AnyAsync (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable whose elements to test for a condition.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Boolean
- A task that represents the asynchronous operation.
- The task result contains
true if any elements in the source sequence pass the test in the specified
- predicate; otherwise,
false .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/e2378abf-9ba7-31b2-2611-2a470fc31a9c.htm b/docs/html/e2378abf-9ba7-31b2-2611-2a470fc31a9c.htm
deleted file mode 100644
index 4b1661242..000000000
--- a/docs/html/e2378abf-9ba7-31b2-2611-2a470fc31a9c.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicQueryableExtensions.GroupBy Method (IQueryable, String, String) DynamicQueryableExtensions GroupBy Method (IQueryable, String, String)
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax Examplesvar groupResult1 = queryable.GroupBy("NumberPropertyAsKey" , "StringProperty" );
-var groupResult2 = queryable.GroupBy("new (NumberPropertyAsKey, StringPropertyAsKey)" , "new (StringProperty1, StringProperty2)" ); See Also
\ No newline at end of file
diff --git a/docs/html/e342c1b4-0ab2-9ff9-bbcb-78004b2d924d.htm b/docs/html/e342c1b4-0ab2-9ff9-bbcb-78004b2d924d.htm
deleted file mode 100644
index a15784392..000000000
--- a/docs/html/e342c1b4-0ab2-9ff9-bbcb-78004b2d924d.htm
+++ /dev/null
@@ -1,37 +0,0 @@
-
DynamicClass Class
- Provides a base class for dynamic objects.
-
- In addition to the methods defined here, the following items are added using reflection:
- - default constructor
- - constructor with all the properties as parameters (if not linq-to-entities)
- - all properties (also with getter and setters)
- - ToString() method
- - Equals() method
- - GetHashCode() method
-
Inheritance Hierarchy
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic abstract class DynamicClass : DynamicObject The DynamicClass type exposes the following members.
Constructors
-
- Name Description DynamicClass Initializes a new instance of the DynamicClass class
Top Properties
-
- Name Description Item
- Gets or sets the
Object with the specified name.
-
Top Methods See Also
\ No newline at end of file
diff --git a/docs/html/e57952b7-44ac-6a64-264d-6da3aea7093e.htm b/docs/html/e57952b7-44ac-6a64-264d-6da3aea7093e.htm
deleted file mode 100644
index 3d81568e5..000000000
--- a/docs/html/e57952b7-44ac-6a64-264d-6da3aea7093e.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
IExpressionPromoter Methods IExpressionPromoter Methods
The IExpressionPromoter type exposes the following members.
Methods
-
- Name Description Promote
- Promote an expression
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/e5ce2140-397c-9e15-366d-bd68b4c2a748.htm b/docs/html/e5ce2140-397c-9e15-366d-bd68b4c2a748.htm
deleted file mode 100644
index 06a2a4d08..000000000
--- a/docs/html/e5ce2140-397c-9e15-366d-bd68b4c2a748.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicExpressionParser.ParseLambda Method (ParsingConfig, Type, Type, String, Object[])
DynamicExpressionParser ParseLambda Method (ParsingConfig, Type, Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static LambdaExpression ParseLambda (
- ParsingConfig parsingConfig ,
- Type itType ,
- Type resultType ,
- string expression ,
- params Object [] values
-)Parameters parsingConfig Type: System.Linq.Dynamic.Core ParsingConfig The Configuration for the parsing. itType Type: System Type The main type from the dynamic class expression. resultType Type: System Type Type of the result. If not specified, it will be generated dynamically. expression Type: System String The expression. values Type: System Object An object array that contains zero or more objects which are used as replacement values. Return Value Type:
LambdaExpression The generated
LambdaExpression See Also
\ No newline at end of file
diff --git a/docs/html/e6fe222f-ae62-f698-9ab1-f03c31c5d8ce.htm b/docs/html/e6fe222f-ae62-f698-9ab1-f03c31c5d8ce.htm
deleted file mode 100644
index 426f2015f..000000000
--- a/docs/html/e6fe222f-ae62-f698-9ab1-f03c31c5d8ce.htm
+++ /dev/null
@@ -1,8 +0,0 @@
-
DynamicEnumerableAsyncExtensions.ToDynamicListAsync(T) Method (Void) DynamicEnumerableAsyncExtensions ToDynamicListAsyncT Method (Void)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableAsyncExtensions.ToDynamicListAsync``1(System.Void)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static Task <List > ToDynamicListAsync <T>(
- this void source
-)
-Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableAsyncExtensions.ToDynamicListAsync``1(System.Void)"]
Type Parameters T [Missing <typeparam name="T"/> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableAsyncExtensions.ToDynamicListAsync``1(System.Void)"]
Return Value Type:
Task List T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableAsyncExtensions.ToDynamicListAsync``1(System.Void)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/e7bacec7-9ab4-161b-78cb-cec2bb267c78.htm b/docs/html/e7bacec7-9ab4-161b-78cb-cec2bb267c78.htm
deleted file mode 100644
index 392ce1621..000000000
--- a/docs/html/e7bacec7-9ab4-161b-78cb-cec2bb267c78.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
DynamicEnumerableAsyncExtensions.ToDynamicListAsync Method (Void) DynamicEnumerableAsyncExtensions ToDynamicListAsync Method (Void)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableAsyncExtensions.ToDynamicListAsync(System.Void)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static Task <List > ToDynamicListAsync (
- this void source
-)Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableAsyncExtensions.ToDynamicListAsync(System.Void)"]
Return Value Type:
Task List T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableAsyncExtensions.ToDynamicListAsync(System.Void)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/e7f88c42-6076-1782-76c7-7f00bb2ba6b4.htm b/docs/html/e7f88c42-6076-1782-76c7-7f00bb2ba6b4.htm
deleted file mode 100644
index 77835b0cd..000000000
--- a/docs/html/e7f88c42-6076-1782-76c7-7f00bb2ba6b4.htm
+++ /dev/null
@@ -1,19 +0,0 @@
-
DynamicProperty Class
- DynamicProperty
-
Inheritance Hierarchy
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic class DynamicProperty The DynamicProperty type exposes the following members.
Constructors
-
- Name Description DynamicProperty
- Initializes a new instance of the DynamicProperty class.
-
Top Properties
-
- Name Description Name
- Gets the name from the property.
-
Type
- Gets the type from the property.
-
Top Methods
-
- Name Description Equals Determines whether the specified object is equal to the current object.
(Inherited from Object .)Finalize Allows an object to try to free resources and perform other cleanup operations before it is reclaimed by garbage collection.
(Inherited from Object .)GetHashCode Serves as the default hash function.
(Inherited from Object .)GetType Gets the
Type of the current instance.
(Inherited from Object .)MemberwiseClone Creates a shallow copy of the current
Object .
(Inherited from Object .)ToString Returns a string that represents the current object.
(Inherited from Object .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/e8054e46-4edd-0108-00f6-0af9ce5918b9.htm b/docs/html/e8054e46-4edd-0108-00f6-0af9ce5918b9.htm
deleted file mode 100644
index e3aebbd4c..000000000
--- a/docs/html/e8054e46-4edd-0108-00f6-0af9ce5918b9.htm
+++ /dev/null
@@ -1,17 +0,0 @@
-
ExtensibilityPoint Class
- Extensibility point: If you want to modify expanded queries before executing them
- set your own functionality to override empty QueryOptimizer
-
Inheritance Hierarchy
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic class ExtensibilityPoint The ExtensibilityPoint type exposes the following members.
Constructors Methods
-
- Name Description Equals Determines whether the specified object is equal to the current object.
(Inherited from Object .)Finalize Allows an object to try to free resources and perform other cleanup operations before it is reclaimed by garbage collection.
(Inherited from Object .)GetHashCode Serves as the default hash function.
(Inherited from Object .)GetType Gets the
Type of the current instance.
(Inherited from Object .)MemberwiseClone Creates a shallow copy of the current
Object .
(Inherited from Object .)ToString Returns a string that represents the current object.
(Inherited from Object .)
Top Fields
-
- Name Description QueryOptimizer
- Place to optimize your queries. Example: Add a reference to Nuget package Linq.Expression.Optimizer
- and in your program initializers set Extensibility.QueryOptimizer = ExpressionOptimizer.visit;
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/e8e7f714-ca50-7fe7-256f-e8f54169fc8b.htm b/docs/html/e8e7f714-ca50-7fe7-256f-e8f54169fc8b.htm
deleted file mode 100644
index e005cb98c..000000000
--- a/docs/html/e8e7f714-ca50-7fe7-256f-e8f54169fc8b.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
ParsingConfig.AreContextKeywordsEnabled Property ParsingConfig AreContextKeywordsEnabled Property
- Determines if the context keywords (it, parent, and root) are valid and usable inside a Dynamic Linq string expression.
- Does not affect the usability of the equivalent context symbols ($, ^ and ~).
- Default value is true.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic bool AreContextKeywordsEnabled { get ; set ; }Property Value Type:
Boolean See Also
\ No newline at end of file
diff --git a/docs/html/eab3892f-592a-49d0-88fa-f3d85dbd1552.htm b/docs/html/eab3892f-592a-49d0-88fa-f3d85dbd1552.htm
deleted file mode 100644
index cf68e750d..000000000
--- a/docs/html/eab3892f-592a-49d0-88fa-f3d85dbd1552.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.Skip Method DynamicQueryableExtensions Skip Method
- Bypasses a specified number of elements in a sequence and then returns the remaining elements.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/eb868b13-25d4-41fb-a03f-4033e93156ab.htm b/docs/html/eb868b13-25d4-41fb-a03f-4033e93156ab.htm
deleted file mode 100644
index 2a96991fa..000000000
--- a/docs/html/eb868b13-25d4-41fb-a03f-4033e93156ab.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicQueryableExtensions.Last Method (IQueryable) DynamicQueryableExtensions Last Method (IQueryable)
- Returns the last element of a sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/ebc33bd5-9e6a-687c-613a-d0e80df20e3e.htm b/docs/html/ebc33bd5-9e6a-687c-613a-d0e80df20e3e.htm
deleted file mode 100644
index 30a704a8a..000000000
--- a/docs/html/ebc33bd5-9e6a-687c-613a-d0e80df20e3e.htm
+++ /dev/null
@@ -1,14 +0,0 @@
-
DynamicQueryableExtensions.GroupBy Method (IQueryable, ParsingConfig, String, String) DynamicQueryableExtensions GroupBy Method (IQueryable, ParsingConfig, String, String)
- Groups the elements of a sequence according to a specified key string function
- and creates a result value from each group and its key.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax Examplesvar groupResult1 = queryable.GroupBy("NumberPropertyAsKey" , "StringProperty" );
-var groupResult2 = queryable.GroupBy("new (NumberPropertyAsKey, StringPropertyAsKey)" , "new (StringProperty1, StringProperty2)" ); See Also
\ No newline at end of file
diff --git a/docs/html/ebe0037e-4a11-896a-6db2-f3601e9fba51.htm b/docs/html/ebe0037e-4a11-896a-6db2-f3601e9fba51.htm
deleted file mode 100644
index 02a43cb38..000000000
--- a/docs/html/ebe0037e-4a11-896a-6db2-f3601e9fba51.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
System.Linq.Dynamic.Core.Parser Namespace System.Linq.Dynamic.Core.Parser Namespace
[Missing <summary> documentation for "N:System.Linq.Dynamic.Core.Parser"]
Classes Interfaces
-
- Interface Description IExpressionPromoter
- Expression promoter is used to promote object or value types
- to their destination type when an automatic promotion is available
- such as: int to int?
-
\ No newline at end of file
diff --git a/docs/html/ecd48c4e-c134-0bf9-c7f7-2cc2de7e15b0.htm b/docs/html/ecd48c4e-c134-0bf9-c7f7-2cc2de7e15b0.htm
deleted file mode 100644
index 8c6b36220..000000000
--- a/docs/html/ecd48c4e-c134-0bf9-c7f7-2cc2de7e15b0.htm
+++ /dev/null
@@ -1,23 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.LastAsync Method (IQueryable, CancellationToken, String, Object[]) EntityFrameworkDynamicQueryableExtensions LastAsync Method (IQueryable, CancellationToken, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > LastAsync (
- this IQueryable source ,
- CancellationToken cancellationToken ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the last element of.
- cancellationToken Type: System.Threading CancellationToken
- A CancellationToken to observe while waiting for the task to complete.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation.
- The task result contains the last element in
source that passes the test in
-
predicate .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/ecf9b2a9-9a1e-1041-3a47-e1ce4b4492e8.htm b/docs/html/ecf9b2a9-9a1e-1041-3a47-e1ce4b4492e8.htm
deleted file mode 100644
index 778a6c3f9..000000000
--- a/docs/html/ecf9b2a9-9a1e-1041-3a47-e1ce4b4492e8.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicExpressionParser.ParseLambda Method (ParsingConfig, Type, String, Object[]) DynamicExpressionParser ParseLambda Method (ParsingConfig, Type, String, Object )
- Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.)
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static LambdaExpression ParseLambda (
- ParsingConfig parsingConfig ,
- Type resultType ,
- string expression ,
- params Object [] values
-)Parameters parsingConfig Type: System.Linq.Dynamic.Core ParsingConfig The Configuration for the parsing. resultType Type: System Type Type of the result. If not specified, it will be generated dynamically. expression Type: System String The expression. values Type: System Object An object array that contains zero or more objects which are used as replacement values. Return Value Type:
LambdaExpression The generated
LambdaExpression See Also
\ No newline at end of file
diff --git a/docs/html/ed7f1515-c1bd-5914-ff3d-a11c448e1288.htm b/docs/html/ed7f1515-c1bd-5914-ff3d-a11c448e1288.htm
deleted file mode 100644
index 2b17a78a2..000000000
--- a/docs/html/ed7f1515-c1bd-5914-ff3d-a11c448e1288.htm
+++ /dev/null
@@ -1,60 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions Class EntityFrameworkDynamicQueryableExtensions Class
- Provides a set of static Async methods for querying data structures that implement
IQueryable .
- It allows dynamic string based querying. Very handy when, at compile time, you don't know the type of queries that will be generated,
- or when downstream components only return column names to sort and filter by.
-
Inheritance HierarchySystem Object Microsoft.EntityFrameworkCore.DynamicLinq EntityFrameworkDynamicQueryableExtensions
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static class EntityFrameworkDynamicQueryableExtensions Methods
-
- Name Description AnyAsync(IQueryable, CancellationToken)
- Asynchronously determines whether a sequence contains any elements.
-
AnyAsync(IQueryable, String, Object )
- Asynchronously determines whether any element of a sequence satisfies a condition.
-
AnyAsync(IQueryable, String, CancellationToken, Object )
- Asynchronously determines whether any element of a sequence satisfies a condition.
-
CountAsync(IQueryable, CancellationToken)
- Asynchronously returns the number of elements in a sequence.
-
CountAsync(IQueryable, String, Object )
- Asynchronously returns the number of elements in a sequence that satisfy a condition.
-
CountAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the number of elements in a sequence that satisfy a condition.
-
FirstAsync(IQueryable, CancellationToken)
- Asynchronously returns the first element of a sequence.
-
FirstAsync(IQueryable, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition.
-
FirstAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition.
-
FirstOrDefaultAsync(IQueryable, CancellationToken)
- Asynchronously returns the first element of a sequence, or a default value if the sequence contains no elements.
-
FirstOrDefaultAsync(IQueryable, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition
- or a default value if no such element is found.
-
FirstOrDefaultAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition
- or a default value if no such element is found.
-
LastAsync(IQueryable, CancellationToken)
- Asynchronously returns the last element of a sequence. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastAsync(IQueryable, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastOrDefaultAsync(IQueryable, CancellationToken)
- Asynchronously returns the last element of a sequence, or a default value if the sequence contains no elements. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastOrDefaultAsync(IQueryable, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition
- or a default value if no such element is found. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
LastOrDefaultAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the last element of a sequence that satisfies a specified condition
- or a default value if no such element is found. [Maybe not supported : https://msdn.microsoft.com/en-us/library/bb738550.aspx]
-
SingleOrDefaultAsync(IQueryable, CancellationToken)
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
SingleOrDefaultAsync(IQueryable, String, Object )
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
SingleOrDefaultAsync(IQueryable, CancellationToken, String, Object )
- Asynchronously returns the only element of a sequence that satisfies a specified condition or a default value if no such element exists.
- This method throws an exception if more than one element satisfies the condition.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/ed8ecef6-0089-eab6-3c3c-e76b190ea7e8.htm b/docs/html/ed8ecef6-0089-eab6-3c3c-e76b190ea7e8.htm
deleted file mode 100644
index 2d89c2fa2..000000000
--- a/docs/html/ed8ecef6-0089-eab6-3c3c-e76b190ea7e8.htm
+++ /dev/null
@@ -1,15 +0,0 @@
-
IDynamicLinkCustomTypeProvider Interface IDynamicLinkCustomTypeProvider Interface
- Interface for providing functionality to find custom types for or resolve any type.
-
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic interface IDynamicLinkCustomTypeProvider The IDynamicLinkCustomTypeProvider type exposes the following members.
Methods
-
- Name Description GetCustomTypes
- Returns a list of custom types that System.Linq.Dynamic.Core will understand.
-
ResolveType
- Resolve any type by fullname which is registered in the current application domain.
-
ResolveTypeBySimpleName
- Resolve any type by the simple name which is registered in the current application domain.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/edf69e8b-5fef-a4e6-8b8b-ccf9cd04ddfb.htm b/docs/html/edf69e8b-5fef-a4e6-8b8b-ccf9cd04ddfb.htm
deleted file mode 100644
index e6c508103..000000000
--- a/docs/html/edf69e8b-5fef-a4e6-8b8b-ccf9cd04ddfb.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicQueryableExtensions.Select Method (IQueryable, ParsingConfig, String, Object[]) DynamicQueryableExtensions Select Method (IQueryable, ParsingConfig, String, Object )
- Projects each element of a sequence into a new form.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax Examplesvar singleField = queryable.Select("StringProperty" );
-var dynamicObject = queryable.Select("new (StringProperty1, StringProperty2 as OtherStringPropertyName)" ); See Also
\ No newline at end of file
diff --git a/docs/html/ee19ea95-08a2-85c3-0e1a-7c0ac93345dd.htm b/docs/html/ee19ea95-08a2-85c3-0e1a-7c0ac93345dd.htm
deleted file mode 100644
index 04c0f2f83..000000000
--- a/docs/html/ee19ea95-08a2-85c3-0e1a-7c0ac93345dd.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.LastOrDefault Method DynamicQueryableExtensions LastOrDefault Method
Overload List
-
- Name Description LastOrDefault(IQueryable)
- Returns the last element of a sequence, or a default value if the sequence contains no elements.
-
LastOrDefault(IQueryable, LambdaExpression)
- Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements.
-
LastOrDefault(IQueryable, String, Object )
- Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements.
-
LastOrDefault(IQueryable, ParsingConfig, String, Object )
- Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/ee5bfae2-fceb-ddda-588c-6e9faa2d5ecd.htm b/docs/html/ee5bfae2-fceb-ddda-588c-6e9faa2d5ecd.htm
deleted file mode 100644
index 573747c71..000000000
--- a/docs/html/ee5bfae2-fceb-ddda-588c-6e9faa2d5ecd.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
IQueryableAnalyzer.SupportsLinqToObjects Method IQueryableAnalyzer SupportsLinqToObjects Method
- Determines whether the specified query (and provider) supports LinqToObjects.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxbool SupportsLinqToObjects (
- IQueryable query ,
- IQueryProvider provider = null
-)Parameters query Type: System.Linq IQueryable The query to check. provider (Optional)Type: System.Linq IQueryProvider The provider to check (can be null). Return Value Type:
Boolean true/false
See Also
\ No newline at end of file
diff --git a/docs/html/ee97fc17-7c9a-a908-fa49-215f372075a8.htm b/docs/html/ee97fc17-7c9a-a908-fa49-215f372075a8.htm
deleted file mode 100644
index 119ab7a18..000000000
--- a/docs/html/ee97fc17-7c9a-a908-fa49-215f372075a8.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.OfType Method (IQueryable, ParsingConfig, String) DynamicQueryableExtensions OfType Method (IQueryable, ParsingConfig, String)
- Filters the elements of an
IQueryable based on a specified type.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/eeb7efeb-654f-1951-4973-cf8d1430fd87.htm b/docs/html/eeb7efeb-654f-1951-4973-cf8d1430fd87.htm
deleted file mode 100644
index dcdde2a5f..000000000
--- a/docs/html/eeb7efeb-654f-1951-4973-cf8d1430fd87.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.AnyAsync Method EntityFrameworkDynamicQueryableExtensions AnyAsync Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/ef03b0ca-b4cf-915e-5e1b-364786bea222.htm b/docs/html/ef03b0ca-b4cf-915e-5e1b-364786bea222.htm
deleted file mode 100644
index 19babcfa0..000000000
--- a/docs/html/ef03b0ca-b4cf-915e-5e1b-364786bea222.htm
+++ /dev/null
@@ -1,20 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.FirstAsync Method (IQueryable, String, Object[]) EntityFrameworkDynamicQueryableExtensions FirstAsync Method (IQueryable, String, Object )
- Asynchronously returns the first element of a sequence that satisfies a specified condition.
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntaxpublic static Task <Object > FirstAsync (
- this IQueryable source ,
- string predicate ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable
- An IQueryable to return the first element of.
- predicate Type: System String A function to test each element for a condition. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Return Value Type:
Task Object
- A task that represents the asynchronous operation.
- The task result contains the first element in
source that passes the test in
-
predicate .
-
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/f0a20829-2dee-5e5c-1988-4ca782990edf.htm b/docs/html/f0a20829-2dee-5e5c-1988-4ca782990edf.htm
deleted file mode 100644
index 65da9561f..000000000
--- a/docs/html/f0a20829-2dee-5e5c-1988-4ca782990edf.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.Page(TSource) Method (Void, TSource, IQueryable) DynamicQueryableExtensions PageTSource Method (Void, TSource , IQueryable)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Page``1(System.Void,``0,System.Linq.IQueryable`1)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable Page <TSource>(
- this void source ,
- TSource page ,
- IQueryable pageSize
-)
-Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Page``1(System.Void,``0,System.Linq.IQueryable`1)"]
page Type: TSource [Missing <param name="page"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Page``1(System.Void,``0,System.Linq.IQueryable`1)"]
pageSize Type: System.Linq IQueryable T [Missing <param name="pageSize"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Page``1(System.Void,``0,System.Linq.IQueryable`1)"]
Type Parameters TSource [Missing <typeparam name="TSource"/> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Page``1(System.Void,``0,System.Linq.IQueryable`1)"]
Return Value Type:
IQueryable T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicQueryableExtensions.Page``1(System.Void,``0,System.Linq.IQueryable`1)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/f2ea5189-2610-6bae-9913-0aa54dde1bfe.htm b/docs/html/f2ea5189-2610-6bae-9913-0aa54dde1bfe.htm
deleted file mode 100644
index a622348c9..000000000
--- a/docs/html/f2ea5189-2610-6bae-9913-0aa54dde1bfe.htm
+++ /dev/null
@@ -1,21 +0,0 @@
-
EntityFrameworkDynamicQueryableExtensions.FirstOrDefaultAsync Method (IQueryable, CancellationToken) EntityFrameworkDynamicQueryableExtensions FirstOrDefaultAsync Method (IQueryable, CancellationToken)
- Asynchronously returns the first element of a sequence, or a default value if the sequence contains no elements.
-
-
Namespace:
-
Microsoft.EntityFrameworkCore.DynamicLinq
-
Assembly:
- Microsoft.EntityFrameworkCore.DynamicLinq (in Microsoft.EntityFrameworkCore.DynamicLinq.dll) Version: 1.0.11
Syntax Remarks
- Multiple active operations on the same context instance are not supported. Use 'await' to ensure
- that any asynchronous operations have completed before calling another method on this context.
-
See Also
\ No newline at end of file
diff --git a/docs/html/f356f997-5773-4fd2-803d-e50394851752.htm b/docs/html/f356f997-5773-4fd2-803d-e50394851752.htm
deleted file mode 100644
index 908dfcebe..000000000
--- a/docs/html/f356f997-5773-4fd2-803d-e50394851752.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DefaultDynamicLinqCustomTypeProvider.ResolveTypeBySimpleName Method (String) DefaultDynamicLinqCustomTypeProvider ResolveTypeBySimpleName Method (String)
- Resolve any type by the simple name which is registered in the current application domain.
-
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/f3787db5-ab98-db68-694e-94d2ddd8b140.htm b/docs/html/f3787db5-ab98-db68-694e-94d2ddd8b140.htm
deleted file mode 100644
index 7c3f36229..000000000
--- a/docs/html/f3787db5-ab98-db68-694e-94d2ddd8b140.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicLinqTypeAttribute Class DynamicLinqTypeAttribute Class
- Indicates to Dynamic Linq to consider the Type as a valid dynamic linq type.
-
Inheritance Hierarchy
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic sealed class DynamicLinqTypeAttribute : Attribute The DynamicLinqTypeAttribute type exposes the following members.
Constructors Properties
-
- Name Description TypeId When implemented in a derived class, gets a unique identifier for this
Attribute .
(Inherited from Attribute .)
Top Methods
-
- Name Description Equals Returns a value that indicates whether this instance is equal to a specified object.
(Inherited from Attribute .)GetHashCode Returns the hash code for this instance.
(Inherited from Attribute .)GetType Gets the
Type of the current instance.
(Inherited from Object .)IsDefaultAttribute When overridden in a derived class, indicates whether the value of this instance is the default value for the derived class.
(Inherited from Attribute .)Match When overridden in a derived class, returns a value that indicates whether this instance equals a specified object.
(Inherited from Attribute .)ToString Returns a string that represents the current object.
(Inherited from Object .)
Top See Also
\ No newline at end of file
diff --git a/docs/html/f4706713-1212-b813-600c-468d1315876e.htm b/docs/html/f4706713-1212-b813-600c-468d1315876e.htm
deleted file mode 100644
index 9f4cc7534..000000000
--- a/docs/html/f4706713-1212-b813-600c-468d1315876e.htm
+++ /dev/null
@@ -1,3 +0,0 @@
-
DynamicEnumerableAsyncExtensions.ToDynamicListAsync Method DynamicEnumerableAsyncExtensions ToDynamicListAsync Method
Overload List See Also
\ No newline at end of file
diff --git a/docs/html/f553b938-f70f-c9bd-8e29-682200413e96.htm b/docs/html/f553b938-f70f-c9bd-8e29-682200413e96.htm
deleted file mode 100644
index 17b04fdbd..000000000
--- a/docs/html/f553b938-f70f-c9bd-8e29-682200413e96.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
Microsoft.EntityFrameworkCore.DynamicLinq Namespace Microsoft.EntityFrameworkCore.DynamicLinq Namespace
Dynamic Linq extensions for Microsoft.EntityFrameworkCore which adds Async support
Classes
-
- Class Description DynamicFunctions
- DynamicFunctions (EF.Functions)
-
EntityFrameworkDynamicQueryableExtensions
- Provides a set of static Async methods for querying data structures that implement
IQueryable .
- It allows dynamic string based querying. Very handy when, at compile time, you don't know the type of queries that will be generated,
- or when downstream components only return column names to sort and filter by.
-
\ No newline at end of file
diff --git a/docs/html/f568b7f3-a69a-6a6d-700e-5e2db2eaa795.htm b/docs/html/f568b7f3-a69a-6a6d-700e-5e2db2eaa795.htm
deleted file mode 100644
index 8d5ce3c4c..000000000
--- a/docs/html/f568b7f3-a69a-6a6d-700e-5e2db2eaa795.htm
+++ /dev/null
@@ -1,12 +0,0 @@
-
DynamicQueryableExtensions.GroupByMany(TElement) Method (IEnumerable(TElement), Func(TElement, Object)[]) DynamicQueryableExtensions GroupByManyTElement Method (IEnumerableTElement , FuncTElement , Object )
- Groups the elements of a sequence according to multiple specified key functions
- and creates a result value from each group (and subgroups) and its key.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/f64df3a8-684e-a8a7-362d-5f6b4e903bac.htm b/docs/html/f64df3a8-684e-a8a7-362d-5f6b4e903bac.htm
deleted file mode 100644
index 9ca46d0fb..000000000
--- a/docs/html/f64df3a8-684e-a8a7-362d-5f6b4e903bac.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.DefaultIfEmpty Method (IQueryable, Object) DynamicQueryableExtensions DefaultIfEmpty Method (IQueryable, Object)
- Returns the elements of the specified sequence or the type parameter's default value in a singleton collection if the sequence is empty.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax ExamplesIQueryable queryable = employees.DefaultIfEmpty(new Employee()); See Also
\ No newline at end of file
diff --git a/docs/html/f650cd15-ec57-45ba-d742-226d40cd37e6.htm b/docs/html/f650cd15-ec57-45ba-d742-226d40cd37e6.htm
deleted file mode 100644
index 12fa761c8..000000000
--- a/docs/html/f650cd15-ec57-45ba-d742-226d40cd37e6.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DefaultDynamicLinqCustomTypeProvider.ResolveType Method (String) DefaultDynamicLinqCustomTypeProvider ResolveType Method (String)
- Resolve any type by fullname which is registered in the current application domain.
-
-
Namespace:
-
System.Linq.Dynamic.Core.CustomTypeProviders
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/f6fd3b5a-3d2f-fc65-c489-4d161f6f3072.htm b/docs/html/f6fd3b5a-3d2f-fc65-c489-4d161f6f3072.htm
deleted file mode 100644
index 4b2059d1d..000000000
--- a/docs/html/f6fd3b5a-3d2f-fc65-c489-4d161f6f3072.htm
+++ /dev/null
@@ -1,15 +0,0 @@
-
DynamicEnumerableAsyncExtensions Class DynamicEnumerableAsyncExtensions Class
Inheritance HierarchySystem Object System.Linq.Dynamic.Core DynamicEnumerableAsyncExtensions
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static class DynamicEnumerableAsyncExtensions Methods See Also
\ No newline at end of file
diff --git a/docs/html/f7d5f52e-c819-340a-3fc4-9aa80263945a.htm b/docs/html/f7d5f52e-c819-340a-3fc4-9aa80263945a.htm
deleted file mode 100644
index d96290581..000000000
--- a/docs/html/f7d5f52e-c819-340a-3fc4-9aa80263945a.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
IAssemblyHelper Interface IAssemblyHelper Interface
- IAssemblyHelper interface which is used to retrieve assemblies that have been loaded into the execution context of this application domain.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic interface IAssemblyHelper The IAssemblyHelper type exposes the following members.
Methods
-
- Name Description GetAssemblies
- Gets the assemblies that have been loaded into the execution context of this application domain.
-
Top See Also
\ No newline at end of file
diff --git a/docs/html/f8bf2a0a-9a63-8a01-4591-a46c51a49245.htm b/docs/html/f8bf2a0a-9a63-8a01-4591-a46c51a49245.htm
deleted file mode 100644
index fff11164a..000000000
--- a/docs/html/f8bf2a0a-9a63-8a01-4591-a46c51a49245.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
PagedResult(TSource) Properties PagedResultTSource Properties
The PagedResult TSource generic type exposes the following members.
Properties See Also
\ No newline at end of file
diff --git a/docs/html/f8c59313-dc93-0853-6228-867bda26dcc6.htm b/docs/html/f8c59313-dc93-0853-6228-867bda26dcc6.htm
deleted file mode 100644
index ea134e825..000000000
--- a/docs/html/f8c59313-dc93-0853-6228-867bda26dcc6.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicQueryableExtensions.FirstOrDefault Method (IQueryable) DynamicQueryableExtensions FirstOrDefault Method (IQueryable)
- Returns the first element of a sequence, or a default value if the sequence contains no elements.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/f9de96fd-6adf-74d0-4a13-c82fbea3d236.htm b/docs/html/f9de96fd-6adf-74d0-4a13-c82fbea3d236.htm
deleted file mode 100644
index b185e549f..000000000
--- a/docs/html/f9de96fd-6adf-74d0-4a13-c82fbea3d236.htm
+++ /dev/null
@@ -1,13 +0,0 @@
-
DynamicQueryableExtensions.Select Method (IQueryable, Type, String, Object[]) DynamicQueryableExtensions Select Method (IQueryable, Type, String, Object )
- Projects each element of a sequence into a new class of type TResult.
- Details see http://solutionizing.net/category/linq/
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static IQueryable Select (
- this IQueryable source ,
- Type resultType ,
- string selector ,
- params Object [] args
-)Parameters source Type: System.Linq IQueryable A sequence of values to project. resultType Type: System Type The result type. selector Type: System String A projection string expression to apply to each element. args Type: System Object An object array that contains zero or more objects to insert into the predicate as parameters. Return Value Type:
IQueryable An
IQueryable whose elements are the result of invoking a projection string on each element of source.
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
IQueryable . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
Examplesvar users = queryable.Select(typeof (User), "new (Username, Pwd as Password)" ); See Also
\ No newline at end of file
diff --git a/docs/html/fa3df61c-afaa-9066-2395-c55a3694f0ac.htm b/docs/html/fa3df61c-afaa-9066-2395-c55a3694f0ac.htm
deleted file mode 100644
index 366318300..000000000
--- a/docs/html/fa3df61c-afaa-9066-2395-c55a3694f0ac.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicClass.GetDynamicPropertyValue Method (String) DynamicClass GetDynamicPropertyValue Method (String)
- Gets the dynamic property value by name.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic Object GetDynamicPropertyValue (
- string propertyName
-)Parameters propertyName Type: System String Name of the property. Return Value Type:
Object value
See Also
\ No newline at end of file
diff --git a/docs/html/fb61a659-6588-79ea-a8c0-9a6d9d3cf1c1.htm b/docs/html/fb61a659-6588-79ea-a8c0-9a6d9d3cf1c1.htm
deleted file mode 100644
index 79c51c2f0..000000000
--- a/docs/html/fb61a659-6588-79ea-a8c0-9a6d9d3cf1c1.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicQueryableExtensions.SingleOrDefault Method (IQueryable) DynamicQueryableExtensions SingleOrDefault Method (IQueryable)
- Returns the only element of a sequence, or a default value if the sequence
- is empty; this method throws an exception if there is more than one element
- in the sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/fbeffa2b-5391-c0ef-59a5-cff1df0eb0b4.htm b/docs/html/fbeffa2b-5391-c0ef-59a5-cff1df0eb0b4.htm
deleted file mode 100644
index 4a4059cec..000000000
--- a/docs/html/fbeffa2b-5391-c0ef-59a5-cff1df0eb0b4.htm
+++ /dev/null
@@ -1,9 +0,0 @@
-
DynamicEnumerableExtensions Methods DynamicEnumerableExtensions Methods
Methods See Also
\ No newline at end of file
diff --git a/docs/html/fcd0a2b5-6940-b38e-44c0-4340c6c77000.htm b/docs/html/fcd0a2b5-6940-b38e-44c0-4340c6c77000.htm
deleted file mode 100644
index 71649b21b..000000000
--- a/docs/html/fcd0a2b5-6940-b38e-44c0-4340c6c77000.htm
+++ /dev/null
@@ -1,7 +0,0 @@
-
DynamicEnumerableExtensions.ToDynamicList Method (Void) DynamicEnumerableExtensions ToDynamicList Method (Void)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableExtensions.ToDynamicList(System.Void)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static List ToDynamicList (
- this void source
-)Parameters source Type: System Void [Missing <param name="source"/> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableExtensions.ToDynamicList(System.Void)"]
Return Value Type:
List T [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicEnumerableExtensions.ToDynamicList(System.Void)"]
Usage Note In Visual Basic and C#, you can call this method as an instance method on any object of type
Void . When you use instance method syntax to call this method, omit the first parameter. For more information, see
Extension Methods (Visual Basic) or
Extension Methods (C# Programming Guide) .
See Also
\ No newline at end of file
diff --git a/docs/html/fce0a87e-6632-055c-a4fe-d76c501a15c4.htm b/docs/html/fce0a87e-6632-055c-a4fe-d76c501a15c4.htm
deleted file mode 100644
index 48864659a..000000000
--- a/docs/html/fce0a87e-6632-055c-a4fe-d76c501a15c4.htm
+++ /dev/null
@@ -1,14 +0,0 @@
-
DynamicQueryableExtensions.Select Method (IQueryable, ParsingConfig, Type, String, Object[]) DynamicQueryableExtensions Select Method (IQueryable, ParsingConfig, Type, String, Object )
- Projects each element of a sequence into a new class of type TResult.
- Details see http://solutionizing.net/category/linq/
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax Examplesvar users = queryable.Select(typeof (User), "new (Username, Pwd as Password)" ); See Also
\ No newline at end of file
diff --git a/docs/html/fe1717f7-802b-f5a9-b54a-f764cd84365d.htm b/docs/html/fe1717f7-802b-f5a9-b54a-f764cd84365d.htm
deleted file mode 100644
index 3f89997db..000000000
--- a/docs/html/fe1717f7-802b-f5a9-b54a-f764cd84365d.htm
+++ /dev/null
@@ -1,5 +0,0 @@
-
PagedResult(TSource) Constructor PagedResultTSource Constructor
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/fe6a70ac-d69c-e985-17ee-46b522d89000.htm b/docs/html/fe6a70ac-d69c-e985-17ee-46b522d89000.htm
deleted file mode 100644
index ddf3e48f7..000000000
--- a/docs/html/fe6a70ac-d69c-e985-17ee-46b522d89000.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
DynamicQueryableExtensions.Single Method (IQueryable) DynamicQueryableExtensions Single Method (IQueryable)
- Returns the only element of a sequence, and throws an exception if there
- is not exactly one element in the sequence.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntax See Also
\ No newline at end of file
diff --git a/docs/html/fe770dbc-3af7-16f9-5880-a5b384293307.htm b/docs/html/fe770dbc-3af7-16f9-5880-a5b384293307.htm
deleted file mode 100644
index d9cb821b1..000000000
--- a/docs/html/fe770dbc-3af7-16f9-5880-a5b384293307.htm
+++ /dev/null
@@ -1,11 +0,0 @@
-
DynamicExpressionParser.ParseLambda(TResult) Method (Void, Func(TResult), ParsingConfig, Boolean)
DynamicExpressionParser ParseLambdaTResult Method (Void, FuncTResult , ParsingConfig, Boolean)
[Missing <summary> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``1(System.Void,System.Func{``0},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean)"]
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic static Expression ParseLambda <TResult>(
- void parsingConfig ,
- Func <TResult> createParameterCtor ,
- ParsingConfig expression ,
- params bool values
-)
-Parameters parsingConfig Type: System Void [Missing <param name="parsingConfig"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``1(System.Void,System.Func{``0},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean)"]
createParameterCtor Type: System Func TResult [Missing <param name="createParameterCtor"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``1(System.Void,System.Func{``0},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean)"]
expression Type: System.Linq.Dynamic.Core ParsingConfig [Missing <param name="expression"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``1(System.Void,System.Func{``0},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean)"]
values Type: System Boolean [Missing <param name="values"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``1(System.Void,System.Func{``0},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean)"]
Type Parameters TResult [Missing <typeparam name="TResult"/> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``1(System.Void,System.Func{``0},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean)"]
Return Value Type:
Expression TDelegate [Missing <returns> documentation for "M:System.Linq.Dynamic.Core.DynamicExpressionParser.ParseLambda``1(System.Void,System.Func{``0},System.Linq.Dynamic.Core.ParsingConfig,System.Boolean)"]
See Also
\ No newline at end of file
diff --git a/docs/html/fedbfe40-b8a1-0d02-3781-679de45a1aaf.htm b/docs/html/fedbfe40-b8a1-0d02-3781-679de45a1aaf.htm
deleted file mode 100644
index 7aa34794d..000000000
--- a/docs/html/fedbfe40-b8a1-0d02-3781-679de45a1aaf.htm
+++ /dev/null
@@ -1,10 +0,0 @@
-
ParsingConfig.EvaluateGroupByAtDatabase Property ParsingConfig EvaluateGroupByAtDatabase Property
- Gets or sets a value indicating whether the EntityFramework version supports evaluating GroupBy at database level. Default value is false.
- See https://docs.microsoft.com/en-us/ef/core/what-is-new/ef-core-2.1#linq-groupby-translation
-
- Remark: when this setting is set to 'true', make sure to supply this ParsingConfig as first parameter on the extension methods.
-
-
Namespace:
-
System.Linq.Dynamic.Core
-
Assembly:
- System.Linq.Dynamic.Core (in System.Linq.Dynamic.Core.dll) Version: 1.0.11
Syntaxpublic bool EvaluateGroupByAtDatabase { get ; set ; }Property Value Type:
Boolean See Also
\ No newline at end of file
diff --git a/docs/icons/AlertCaution.png b/docs/icons/AlertCaution.png
deleted file mode 100644
index 78f246f04..000000000
Binary files a/docs/icons/AlertCaution.png and /dev/null differ
diff --git a/docs/icons/AlertNote.png b/docs/icons/AlertNote.png
deleted file mode 100644
index 0ab92b66a..000000000
Binary files a/docs/icons/AlertNote.png and /dev/null differ
diff --git a/docs/icons/AlertSecurity.png b/docs/icons/AlertSecurity.png
deleted file mode 100644
index d40fcefc4..000000000
Binary files a/docs/icons/AlertSecurity.png and /dev/null differ
diff --git a/docs/icons/CFW.gif b/docs/icons/CFW.gif
deleted file mode 100644
index cbcabf1b2..000000000
Binary files a/docs/icons/CFW.gif and /dev/null differ
diff --git a/docs/icons/CodeExample.png b/docs/icons/CodeExample.png
deleted file mode 100644
index a3b9fba4c..000000000
Binary files a/docs/icons/CodeExample.png and /dev/null differ
diff --git a/docs/icons/Search.png b/docs/icons/Search.png
deleted file mode 100644
index 42165b6d6..000000000
Binary files a/docs/icons/Search.png and /dev/null differ
diff --git a/docs/icons/SectionCollapsed.png b/docs/icons/SectionCollapsed.png
deleted file mode 100644
index 8ded1ebc6..000000000
Binary files a/docs/icons/SectionCollapsed.png and /dev/null differ
diff --git a/docs/icons/SectionExpanded.png b/docs/icons/SectionExpanded.png
deleted file mode 100644
index b693921cc..000000000
Binary files a/docs/icons/SectionExpanded.png and /dev/null differ
diff --git a/docs/icons/TocClose.gif b/docs/icons/TocClose.gif
deleted file mode 100644
index e6d7b5edc..000000000
Binary files a/docs/icons/TocClose.gif and /dev/null differ
diff --git a/docs/icons/TocCollapsed.gif b/docs/icons/TocCollapsed.gif
deleted file mode 100644
index 108d49238..000000000
Binary files a/docs/icons/TocCollapsed.gif and /dev/null differ
diff --git a/docs/icons/TocExpanded.gif b/docs/icons/TocExpanded.gif
deleted file mode 100644
index f774d9bb6..000000000
Binary files a/docs/icons/TocExpanded.gif and /dev/null differ
diff --git a/docs/icons/TocOpen.gif b/docs/icons/TocOpen.gif
deleted file mode 100644
index 4992a98a2..000000000
Binary files a/docs/icons/TocOpen.gif and /dev/null differ
diff --git a/docs/icons/favicon.ico b/docs/icons/favicon.ico
deleted file mode 100644
index 2b9963f81..000000000
Binary files a/docs/icons/favicon.ico and /dev/null differ
diff --git a/docs/icons/privclass.gif b/docs/icons/privclass.gif
deleted file mode 100644
index 0939694ce..000000000
Binary files a/docs/icons/privclass.gif and /dev/null differ
diff --git a/docs/icons/privdelegate.gif b/docs/icons/privdelegate.gif
deleted file mode 100644
index d3aa8a65e..000000000
Binary files a/docs/icons/privdelegate.gif and /dev/null differ
diff --git a/docs/icons/privenumeration.gif b/docs/icons/privenumeration.gif
deleted file mode 100644
index 47f387ec2..000000000
Binary files a/docs/icons/privenumeration.gif and /dev/null differ
diff --git a/docs/icons/privevent.gif b/docs/icons/privevent.gif
deleted file mode 100644
index 30db46df7..000000000
Binary files a/docs/icons/privevent.gif and /dev/null differ
diff --git a/docs/icons/privextension.gif b/docs/icons/privextension.gif
deleted file mode 100644
index 51dd267f0..000000000
Binary files a/docs/icons/privextension.gif and /dev/null differ
diff --git a/docs/icons/privfield.gif b/docs/icons/privfield.gif
deleted file mode 100644
index cbf70f7a3..000000000
Binary files a/docs/icons/privfield.gif and /dev/null differ
diff --git a/docs/icons/privinterface.gif b/docs/icons/privinterface.gif
deleted file mode 100644
index f3b7950ad..000000000
Binary files a/docs/icons/privinterface.gif and /dev/null differ
diff --git a/docs/icons/privmethod.gif b/docs/icons/privmethod.gif
deleted file mode 100644
index 71f882264..000000000
Binary files a/docs/icons/privmethod.gif and /dev/null differ
diff --git a/docs/icons/privproperty.gif b/docs/icons/privproperty.gif
deleted file mode 100644
index b1e807465..000000000
Binary files a/docs/icons/privproperty.gif and /dev/null differ
diff --git a/docs/icons/privstructure.gif b/docs/icons/privstructure.gif
deleted file mode 100644
index ed6d1ef68..000000000
Binary files a/docs/icons/privstructure.gif and /dev/null differ
diff --git a/docs/icons/protclass.gif b/docs/icons/protclass.gif
deleted file mode 100644
index 0f9294292..000000000
Binary files a/docs/icons/protclass.gif and /dev/null differ
diff --git a/docs/icons/protdelegate.gif b/docs/icons/protdelegate.gif
deleted file mode 100644
index b209f2d81..000000000
Binary files a/docs/icons/protdelegate.gif and /dev/null differ
diff --git a/docs/icons/protenumeration.gif b/docs/icons/protenumeration.gif
deleted file mode 100644
index cc96bb635..000000000
Binary files a/docs/icons/protenumeration.gif and /dev/null differ
diff --git a/docs/icons/protevent.gif b/docs/icons/protevent.gif
deleted file mode 100644
index 0e510b272..000000000
Binary files a/docs/icons/protevent.gif and /dev/null differ
diff --git a/docs/icons/protextension.gif b/docs/icons/protextension.gif
deleted file mode 100644
index dcd07f5e1..000000000
Binary files a/docs/icons/protextension.gif and /dev/null differ
diff --git a/docs/icons/protfield.gif b/docs/icons/protfield.gif
deleted file mode 100644
index 9ae6833e0..000000000
Binary files a/docs/icons/protfield.gif and /dev/null differ
diff --git a/docs/icons/protinterface.gif b/docs/icons/protinterface.gif
deleted file mode 100644
index a1b96d2c6..000000000
Binary files a/docs/icons/protinterface.gif and /dev/null differ
diff --git a/docs/icons/protmethod.gif b/docs/icons/protmethod.gif
deleted file mode 100644
index 2bc946873..000000000
Binary files a/docs/icons/protmethod.gif and /dev/null differ
diff --git a/docs/icons/protoperator.gif b/docs/icons/protoperator.gif
deleted file mode 100644
index 2cb75ab8b..000000000
Binary files a/docs/icons/protoperator.gif and /dev/null differ
diff --git a/docs/icons/protproperty.gif b/docs/icons/protproperty.gif
deleted file mode 100644
index 55473d16e..000000000
Binary files a/docs/icons/protproperty.gif and /dev/null differ
diff --git a/docs/icons/protstructure.gif b/docs/icons/protstructure.gif
deleted file mode 100644
index af356a1db..000000000
Binary files a/docs/icons/protstructure.gif and /dev/null differ
diff --git a/docs/icons/pubclass.gif b/docs/icons/pubclass.gif
deleted file mode 100644
index 1a968ab63..000000000
Binary files a/docs/icons/pubclass.gif and /dev/null differ
diff --git a/docs/icons/pubdelegate.gif b/docs/icons/pubdelegate.gif
deleted file mode 100644
index 0a43eb261..000000000
Binary files a/docs/icons/pubdelegate.gif and /dev/null differ
diff --git a/docs/icons/pubenumeration.gif b/docs/icons/pubenumeration.gif
deleted file mode 100644
index 46888adef..000000000
Binary files a/docs/icons/pubenumeration.gif and /dev/null differ
diff --git a/docs/icons/pubevent.gif b/docs/icons/pubevent.gif
deleted file mode 100644
index b9226da8b..000000000
Binary files a/docs/icons/pubevent.gif and /dev/null differ
diff --git a/docs/icons/pubextension.gif b/docs/icons/pubextension.gif
deleted file mode 100644
index 6262d1cca..000000000
Binary files a/docs/icons/pubextension.gif and /dev/null differ
diff --git a/docs/icons/pubfield.gif b/docs/icons/pubfield.gif
deleted file mode 100644
index 5aed17576..000000000
Binary files a/docs/icons/pubfield.gif and /dev/null differ
diff --git a/docs/icons/pubinterface.gif b/docs/icons/pubinterface.gif
deleted file mode 100644
index c38a4c46a..000000000
Binary files a/docs/icons/pubinterface.gif and /dev/null differ
diff --git a/docs/icons/pubmethod.gif b/docs/icons/pubmethod.gif
deleted file mode 100644
index 2c72988f5..000000000
Binary files a/docs/icons/pubmethod.gif and /dev/null differ
diff --git a/docs/icons/puboperator.gif b/docs/icons/puboperator.gif
deleted file mode 100644
index 0ebe10a7e..000000000
Binary files a/docs/icons/puboperator.gif and /dev/null differ
diff --git a/docs/icons/pubproperty.gif b/docs/icons/pubproperty.gif
deleted file mode 100644
index dfad7b430..000000000
Binary files a/docs/icons/pubproperty.gif and /dev/null differ
diff --git a/docs/icons/pubstructure.gif b/docs/icons/pubstructure.gif
deleted file mode 100644
index 1344416ab..000000000
Binary files a/docs/icons/pubstructure.gif and /dev/null differ
diff --git a/docs/icons/slMobile.gif b/docs/icons/slMobile.gif
deleted file mode 100644
index 5edc31f94..000000000
Binary files a/docs/icons/slMobile.gif and /dev/null differ
diff --git a/docs/icons/static.gif b/docs/icons/static.gif
deleted file mode 100644
index 33723a92b..000000000
Binary files a/docs/icons/static.gif and /dev/null differ
diff --git a/docs/icons/xna.gif b/docs/icons/xna.gif
deleted file mode 100644
index 9e6a9d4bd..000000000
Binary files a/docs/icons/xna.gif and /dev/null differ
diff --git a/docs/index.html b/docs/index.html
index 66dc85338..d8d1d3e79 100644
--- a/docs/index.html
+++ b/docs/index.html
@@ -1,14 +1,124 @@
-
-
-
-
-
-
System.Linq.Dynamic.Core, EntityFramework.DynamicLinq and Microsoft.EntityFrameworkCore.DynamicLinq - Redirect
-
-
-
If you are not redirected automatically, follow this link to the default topic .
-
+
+
+
+
+
+
+
System.Linq.Dynamic.Core
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Search Results for
+
+
+
+
+
+
+
+
+System.Linq.Dynamic.Core
+
+This is a .NET Core / Standard port of the Microsoft assembly for the .Net 4.0 Dynamic language functionality.
+Overview
+With this library it's possible to write Dynamic LINQ queries (string based) on an IQueryable:
+var query = db.Customers
+ .Where("City == @0 and Orders.Count >= @1", "London", 10)
+ .OrderBy("CompanyName")
+ .Select("new(CompanyName as Name, Phone)");
+
+API Documentation
+See this link .
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/docs/index.json b/docs/index.json
new file mode 100644
index 000000000..09879019a
--- /dev/null
+++ b/docs/index.json
@@ -0,0 +1,197 @@
+{
+ "api/System.html": {
+ "href": "api/System.html",
+ "title": "Namespace System",
+ "keywords": "Namespace System Classes Tuple
Represents a 2-tuple, or pair."
+ },
+ "api/System.Linq.Dynamic.Core.Config.html": {
+ "href": "api/System.Linq.Dynamic.Core.Config.html",
+ "title": "Namespace System.Linq.Dynamic.Core.Config",
+ "keywords": "Namespace System.Linq.Dynamic.Core.Config Enums StringLiteralParsingType Defines the types of string literal parsing that can be performed."
+ },
+ "api/System.Linq.Dynamic.Core.Config.StringLiteralParsingType.html": {
+ "href": "api/System.Linq.Dynamic.Core.Config.StringLiteralParsingType.html",
+ "title": "Enum StringLiteralParsingType",
+ "keywords": "Enum StringLiteralParsingType Defines the types of string literal parsing that can be performed. Namespace : System.Linq.Dynamic.Core.Config Assembly : System.Linq.Dynamic.Core.dll Syntax public enum StringLiteralParsingType : byte Fields Name Description Default Represents the default string literal parsing type. Double quotes should be escaped using the default escape character (a ). To check if a Value equals a double quote, use this c# code: var expression = \"Value == \\\"\\\\\\\"\\\"\"; EscapeDoubleQuoteByTwoDoubleQuotes Represents a string literal parsing type where a double quote should be escaped by an extra double quote (\"). To check if a Value equals a double quote, use this c# code: var expression = \"Value == \\\"\\\"\\\"\\\"\";"
+ },
+ "api/System.Linq.Dynamic.Core.CustomTypeProviders.AbstractDynamicLinqCustomTypeProvider.html": {
+ "href": "api/System.Linq.Dynamic.Core.CustomTypeProviders.AbstractDynamicLinqCustomTypeProvider.html",
+ "title": "Class AbstractDynamicLinqCustomTypeProvider",
+ "keywords": "Class AbstractDynamicLinqCustomTypeProvider The abstract DynamicLinqCustomTypeProvider which is used by the DefaultDynamicLinqCustomTypeProvider and can be used by a custom TypeProvider like in .NET Core. Inheritance System.Object AbstractDynamicLinqCustomTypeProvider DefaultDynamicLinqCustomTypeProvider Inherited Members System.Object.ToString() System.Object.Equals(System.Object) System.Object.Equals(System.Object, System.Object) System.Object.ReferenceEquals(System.Object, System.Object) System.Object.GetHashCode() System.Object.GetType() System.Object.MemberwiseClone() Namespace : System.Linq.Dynamic.Core.CustomTypeProviders Assembly : System.Linq.Dynamic.Core.dll Syntax public abstract class AbstractDynamicLinqCustomTypeProvider Methods | Improve this Doc View Source FindTypesMarkedWithDynamicLinqTypeAttribute(IEnumerable) Finds the unique types marked with DynamicLinqTypeAttribute. Declaration protected IEnumerable FindTypesMarkedWithDynamicLinqTypeAttribute(IEnumerable assemblies) Parameters Type Name Description System.Collections.Generic.IEnumerable < System.Reflection.Assembly > assemblies The assemblies to process. Returns Type Description System.Collections.Generic.IEnumerable < System.Type > System.Collections.Generic.IEnumerable | Improve this Doc View Source GetAssemblyTypesWithDynamicLinqTypeAttribute(IEnumerable) Gets the assembly types annotated with DynamicLinqTypeAttribute in an Exception friendly way. Declaration protected Type[] GetAssemblyTypesWithDynamicLinqTypeAttribute(IEnumerable assemblies) Parameters Type Name Description System.Collections.Generic.IEnumerable < System.Reflection.Assembly > assemblies The assemblies to process. Returns Type Description System.Type [] Array of System.Type | Improve this Doc View Source ResolveType(IEnumerable, String) Resolve any type which is registered in the current application domain. Declaration protected Type ResolveType(IEnumerable assemblies, string typeName) Parameters Type Name Description System.Collections.Generic.IEnumerable < System.Reflection.Assembly > assemblies The assemblies to inspect. System.String typeName The typename to resolve. Returns Type Description System.Type A resolved System.Type or null when not found. | Improve this Doc View Source ResolveTypeBySimpleName(IEnumerable, String) Resolve a type by the simple name which is registered in the current application domain. Declaration protected Type ResolveTypeBySimpleName(IEnumerable assemblies, string simpleTypeName) Parameters Type Name Description System.Collections.Generic.IEnumerable < System.Reflection.Assembly > assemblies The assemblies to inspect. System.String simpleTypeName The simple typename to resolve. Returns Type Description System.Type A resolved System.Type or null when not found."
+ },
+ "api/System.Linq.Dynamic.Core.CustomTypeProviders.DefaultDynamicLinqCustomTypeProvider.html": {
+ "href": "api/System.Linq.Dynamic.Core.CustomTypeProviders.DefaultDynamicLinqCustomTypeProvider.html",
+ "title": "Class DefaultDynamicLinqCustomTypeProvider",
+ "keywords": "Class DefaultDynamicLinqCustomTypeProvider The default implementation for DefaultDynamicLinqCustomTypeProvider . Scans the current AppDomain for all types marked with DynamicLinqTypeAttribute , and adds them as custom Dynamic Link types. Also provides functionality to resolve a Type in the current Application Domain. This class is used as default for full .NET Framework and .NET Core App 2.x and higher. Inheritance System.Object AbstractDynamicLinqCustomTypeProvider DefaultDynamicLinqCustomTypeProvider Implements IDynamicLinkCustomTypeProvider IDynamicLinqCustomTypeProvider Inherited Members AbstractDynamicLinqCustomTypeProvider.FindTypesMarkedWithDynamicLinqTypeAttribute(IEnumerable) AbstractDynamicLinqCustomTypeProvider.ResolveType(IEnumerable, String) AbstractDynamicLinqCustomTypeProvider.ResolveTypeBySimpleName(IEnumerable, String) AbstractDynamicLinqCustomTypeProvider.GetAssemblyTypesWithDynamicLinqTypeAttribute(IEnumerable) System.Object.ToString() System.Object.Equals(System.Object) System.Object.Equals(System.Object, System.Object) System.Object.ReferenceEquals(System.Object, System.Object) System.Object.GetHashCode() System.Object.GetType() System.Object.MemberwiseClone() Namespace : System.Linq.Dynamic.Core.CustomTypeProviders Assembly : System.Linq.Dynamic.Core.dll Syntax public class DefaultDynamicLinqCustomTypeProvider : AbstractDynamicLinqCustomTypeProvider, IDynamicLinkCustomTypeProvider, IDynamicLinqCustomTypeProvider Constructors | Improve this Doc View Source DefaultDynamicLinqCustomTypeProvider(Boolean) Initializes a new instance of the DefaultDynamicLinqCustomTypeProvider class. Backwards compatibility for issue https://github.com/zzzprojects/System.Linq.Dynamic.Core/issues/830 . Declaration [Obsolete(\"Please use the DefaultDynamicLinqCustomTypeProvider(ParsingConfig config, bool cacheCustomTypes = true) constructor.\")] public DefaultDynamicLinqCustomTypeProvider(bool cacheCustomTypes = true) Parameters Type Name Description System.Boolean cacheCustomTypes Defines whether to cache the CustomTypes (including extension methods) which are found in the Application Domain. Default set to 'true'. | Improve this Doc View Source DefaultDynamicLinqCustomTypeProvider(ParsingConfig, Boolean) Initializes a new instance of the DefaultDynamicLinqCustomTypeProvider class. Declaration public DefaultDynamicLinqCustomTypeProvider(ParsingConfig config, bool cacheCustomTypes = true) Parameters Type Name Description ParsingConfig config The parsing configuration. System.Boolean cacheCustomTypes Defines whether to cache the CustomTypes (including extension methods) which are found in the Application Domain. Default set to 'true'. Methods | Improve this Doc View Source GetCustomTypes() Returns a list of custom types that System.Linq.Dynamic.Core will understand. Declaration public virtual HashSet GetCustomTypes() Returns Type Description System.Collections.Generic.HashSet < System.Type > A System.Collections.Generic.HashSet list of custom types. | Improve this Doc View Source GetExtensionMethods() Returns a list of custom extension methods that System.Linq.Dynamic.Core will understand. Declaration public Dictionary> GetExtensionMethods() Returns Type Description System.Collections.Generic.Dictionary < System.Type , System.Collections.Generic.List < System.Reflection.MethodInfo >> A list of custom extension methods that System.Linq.Dynamic.Core will understand. | Improve this Doc View Source ResolveType(String) Resolve any type by fullname which is registered in the current application domain. Declaration public Type ResolveType(string typeName) Parameters Type Name Description System.String typeName The typename to resolve. Returns Type Description System.Type A resolved System.Type or null when not found. | Improve this Doc View Source ResolveTypeBySimpleName(String) Resolve any type by the simple name which is registered in the current application domain. Declaration public Type ResolveTypeBySimpleName(string simpleTypeName) Parameters Type Name Description System.String simpleTypeName The typename to resolve. Returns Type Description System.Type A resolved System.Type or null when not found. Implements IDynamicLinkCustomTypeProvider IDynamicLinqCustomTypeProvider"
+ },
+ "api/System.Linq.Dynamic.Core.CustomTypeProviders.DynamicLinqTypeAttribute.html": {
+ "href": "api/System.Linq.Dynamic.Core.CustomTypeProviders.DynamicLinqTypeAttribute.html",
+ "title": "Class DynamicLinqTypeAttribute",
+ "keywords": "Class DynamicLinqTypeAttribute Indicates to Dynamic Linq to consider the Type as a valid dynamic linq type. Inheritance System.Object System.Attribute DynamicLinqTypeAttribute Implements System.Runtime.InteropServices._Attribute Inherited Members System.Attribute.GetCustomAttributes(System.Reflection.MemberInfo, System.Type) System.Attribute.GetCustomAttributes(System.Reflection.MemberInfo, System.Type, System.Boolean) System.Attribute.GetCustomAttributes(System.Reflection.MemberInfo) System.Attribute.GetCustomAttributes(System.Reflection.MemberInfo, System.Boolean) System.Attribute.IsDefined(System.Reflection.MemberInfo, System.Type) System.Attribute.IsDefined(System.Reflection.MemberInfo, System.Type, System.Boolean) System.Attribute.GetCustomAttribute(System.Reflection.MemberInfo, System.Type) System.Attribute.GetCustomAttribute(System.Reflection.MemberInfo, System.Type, System.Boolean) System.Attribute.GetCustomAttributes(System.Reflection.ParameterInfo) System.Attribute.GetCustomAttributes(System.Reflection.ParameterInfo, System.Type) System.Attribute.GetCustomAttributes(System.Reflection.ParameterInfo, System.Type, System.Boolean) System.Attribute.GetCustomAttributes(System.Reflection.ParameterInfo, System.Boolean) System.Attribute.IsDefined(System.Reflection.ParameterInfo, System.Type) System.Attribute.IsDefined(System.Reflection.ParameterInfo, System.Type, System.Boolean) System.Attribute.GetCustomAttribute(System.Reflection.ParameterInfo, System.Type) System.Attribute.GetCustomAttribute(System.Reflection.ParameterInfo, System.Type, System.Boolean) System.Attribute.GetCustomAttributes(System.Reflection.Module, System.Type) System.Attribute.GetCustomAttributes(System.Reflection.Module) System.Attribute.GetCustomAttributes(System.Reflection.Module, System.Boolean) System.Attribute.GetCustomAttributes(System.Reflection.Module, System.Type, System.Boolean) System.Attribute.IsDefined(System.Reflection.Module, System.Type) System.Attribute.IsDefined(System.Reflection.Module, System.Type, System.Boolean) System.Attribute.GetCustomAttribute(System.Reflection.Module, System.Type) System.Attribute.GetCustomAttribute(System.Reflection.Module, System.Type, System.Boolean) System.Attribute.GetCustomAttributes(System.Reflection.Assembly, System.Type) System.Attribute.GetCustomAttributes(System.Reflection.Assembly, System.Type, System.Boolean) System.Attribute.GetCustomAttributes(System.Reflection.Assembly) System.Attribute.GetCustomAttributes(System.Reflection.Assembly, System.Boolean) System.Attribute.IsDefined(System.Reflection.Assembly, System.Type) System.Attribute.IsDefined(System.Reflection.Assembly, System.Type, System.Boolean) System.Attribute.GetCustomAttribute(System.Reflection.Assembly, System.Type) System.Attribute.GetCustomAttribute(System.Reflection.Assembly, System.Type, System.Boolean) System.Attribute.Equals(System.Object) System.Attribute.GetHashCode() System.Attribute.Match(System.Object) System.Attribute.IsDefaultAttribute() System.Attribute.System.Runtime.InteropServices._Attribute.GetTypeInfoCount(System.UInt32) System.Attribute.System.Runtime.InteropServices._Attribute.GetTypeInfo(System.UInt32, System.UInt32, System.IntPtr) System.Attribute.System.Runtime.InteropServices._Attribute.GetIDsOfNames(System.Guid, System.IntPtr, System.UInt32, System.UInt32, System.IntPtr) System.Attribute.System.Runtime.InteropServices._Attribute.Invoke(System.UInt32, System.Guid, System.UInt32, System.Int16, System.IntPtr, System.IntPtr, System.IntPtr, System.IntPtr) System.Attribute.TypeId System.Object.ToString() System.Object.Equals(System.Object, System.Object) System.Object.ReferenceEquals(System.Object, System.Object) System.Object.GetType() System.Object.MemberwiseClone() Namespace : System.Linq.Dynamic.Core.CustomTypeProviders Assembly : System.Linq.Dynamic.Core.dll Syntax [AttributeUsage(AttributeTargets.Class | AttributeTargets.Struct | AttributeTargets.Enum | AttributeTargets.Interface, AllowMultiple = false, Inherited = false)] public sealed class DynamicLinqTypeAttribute : Attribute, _Attribute Implements System.Runtime.InteropServices._Attribute"
+ },
+ "api/System.Linq.Dynamic.Core.CustomTypeProviders.html": {
+ "href": "api/System.Linq.Dynamic.Core.CustomTypeProviders.html",
+ "title": "Namespace System.Linq.Dynamic.Core.CustomTypeProviders",
+ "keywords": "Namespace System.Linq.Dynamic.Core.CustomTypeProviders Classes AbstractDynamicLinqCustomTypeProvider The abstract DynamicLinqCustomTypeProvider which is used by the DefaultDynamicLinqCustomTypeProvider and can be used by a custom TypeProvider like in .NET Core. DefaultDynamicLinqCustomTypeProvider The default implementation for DefaultDynamicLinqCustomTypeProvider . Scans the current AppDomain for all types marked with DynamicLinqTypeAttribute , and adds them as custom Dynamic Link types. Also provides functionality to resolve a Type in the current Application Domain. This class is used as default for full .NET Framework and .NET Core App 2.x and higher. DynamicLinqTypeAttribute Indicates to Dynamic Linq to consider the Type as a valid dynamic linq type. Interfaces IDynamicLinkCustomTypeProvider Interface for providing functionality to find custom types for or resolve any type. Note that this interface will be marked obsolete in the next version. Use IDynamicLinqCustomTypeProvider instead. IDynamicLinqCustomTypeProvider Interface for providing functionality to find custom types for or resolve any type."
+ },
+ "api/System.Linq.Dynamic.Core.CustomTypeProviders.IDynamicLinkCustomTypeProvider.html": {
+ "href": "api/System.Linq.Dynamic.Core.CustomTypeProviders.IDynamicLinkCustomTypeProvider.html",
+ "title": "Interface IDynamicLinkCustomTypeProvider",
+ "keywords": "Interface IDynamicLinkCustomTypeProvider Interface for providing functionality to find custom types for or resolve any type. Note that this interface will be marked obsolete in the next version. Use IDynamicLinqCustomTypeProvider instead. Inherited Members IDynamicLinqCustomTypeProvider.GetCustomTypes() IDynamicLinqCustomTypeProvider.GetExtensionMethods() IDynamicLinqCustomTypeProvider.ResolveType(String) IDynamicLinqCustomTypeProvider.ResolveTypeBySimpleName(String) Namespace : System.Linq.Dynamic.Core.CustomTypeProviders Assembly : System.Linq.Dynamic.Core.dll Syntax public interface IDynamicLinkCustomTypeProvider : IDynamicLinqCustomTypeProvider"
+ },
+ "api/System.Linq.Dynamic.Core.CustomTypeProviders.IDynamicLinqCustomTypeProvider.html": {
+ "href": "api/System.Linq.Dynamic.Core.CustomTypeProviders.IDynamicLinqCustomTypeProvider.html",
+ "title": "Interface IDynamicLinqCustomTypeProvider",
+ "keywords": "Interface IDynamicLinqCustomTypeProvider Interface for providing functionality to find custom types for or resolve any type. Namespace : System.Linq.Dynamic.Core.CustomTypeProviders Assembly : System.Linq.Dynamic.Core.dll Syntax public interface IDynamicLinqCustomTypeProvider Methods | Improve this Doc View Source GetCustomTypes() Returns a list of custom types that System.Linq.Dynamic.Core will understand. Declaration HashSet GetCustomTypes() Returns Type Description System.Collections.Generic.HashSet < System.Type > A System.Collections.Generic.HashSet list of custom types. | Improve this Doc View Source GetExtensionMethods() Returns a list of custom extension methods that System.Linq.Dynamic.Core will understand. Declaration Dictionary> GetExtensionMethods() Returns Type Description System.Collections.Generic.Dictionary < System.Type , System.Collections.Generic.List < System.Reflection.MethodInfo >> A list of custom extension methods that System.Linq.Dynamic.Core will understand. | Improve this Doc View Source ResolveType(String) Resolve any type by fullname which is registered in the current application domain. Declaration Type ResolveType(string typeName) Parameters Type Name Description System.String typeName The typename to resolve. Returns Type Description System.Type A resolved System.Type or null when not found. | Improve this Doc View Source ResolveTypeBySimpleName(String) Resolve any type by the simple name which is registered in the current application domain. Declaration Type ResolveTypeBySimpleName(string simpleTypeName) Parameters Type Name Description System.String simpleTypeName The typename to resolve. Returns Type Description System.Type A resolved System.Type or null when not found."
+ },
+ "api/System.Linq.Dynamic.Core.DefaultQueryableAnalyzer.html": {
+ "href": "api/System.Linq.Dynamic.Core.DefaultQueryableAnalyzer.html",
+ "title": "Class DefaultQueryableAnalyzer",
+ "keywords": "Class DefaultQueryableAnalyzer Default implementation. Inheritance System.Object DefaultQueryableAnalyzer Implements IQueryableAnalyzer Inherited Members System.Object.ToString() System.Object.Equals(System.Object) System.Object.Equals(System.Object, System.Object) System.Object.ReferenceEquals(System.Object, System.Object) System.Object.GetHashCode() System.Object.GetType() System.Object.MemberwiseClone() Namespace : System.Linq.Dynamic.Core Assembly : System.Linq.Dynamic.Core.dll Syntax public class DefaultQueryableAnalyzer : IQueryableAnalyzer Methods | Improve this Doc View Source SupportsLinqToObjects(IQueryable, IQueryProvider) Determines whether the specified query (and provider) supports LinqToObjects. Declaration public bool SupportsLinqToObjects(IQueryable query, IQueryProvider provider = null) Parameters Type Name Description System.Linq.IQueryable query The query to check. System.Linq.IQueryProvider provider The provider to check (can be null). Returns Type Description System.Boolean true/false Implements IQueryableAnalyzer See Also IQueryableAnalyzer"
+ },
+ "api/System.Linq.Dynamic.Core.DynamicClass.html": {
+ "href": "api/System.Linq.Dynamic.Core.DynamicClass.html",
+ "title": "Class DynamicClass",
+ "keywords": "Class DynamicClass Provides a base class for dynamic objects for Net 3.5 Inheritance System.Object DynamicClass Inherited Members System.Object.ToString() System.Object.Equals(System.Object) System.Object.Equals(System.Object, System.Object) System.Object.ReferenceEquals(System.Object, System.Object) System.Object.GetHashCode() System.Object.GetType() System.Object.MemberwiseClone() Namespace : System.Linq.Dynamic.Core Assembly : System.Linq.Dynamic.Core.dll Syntax public abstract class DynamicClass Methods | Improve this Doc View Source GetDynamicPropertyValue(String) Gets the dynamic property value by name. Declaration public object GetDynamicPropertyValue(string propertyName) Parameters Type Name Description System.String propertyName Name of the property. Returns Type Description System.Object value | Improve this Doc View Source GetDynamicPropertyValue(String) Gets the dynamic property by name. Declaration public T GetDynamicPropertyValue(string propertyName) Parameters Type Name Description System.String propertyName Name of the property. Returns Type Description T T Type Parameters Name Description T The type. | Improve this Doc View Source SetDynamicPropertyValue(String, Object) Sets the dynamic property value by name. Declaration public void SetDynamicPropertyValue(string propertyName, object value) Parameters Type Name Description System.String propertyName Name of the property. System.Object value The value. | Improve this Doc View Source SetDynamicPropertyValue(String, T) Sets the dynamic property value by name. Declaration public void SetDynamicPropertyValue(string propertyName, T value) Parameters Type Name Description System.String propertyName Name of the property. T value The value. Type Parameters Name Description T The type."
+ },
+ "api/System.Linq.Dynamic.Core.DynamicClassFactory.html": {
+ "href": "api/System.Linq.Dynamic.Core.DynamicClassFactory.html",
+ "title": "Class DynamicClassFactory",
+ "keywords": "Class DynamicClassFactory A factory to create dynamic classes, based on http://stackoverflow.com/questions/29413942/c-sharp-anonymous-object-with-properties-from-dictionary . Inheritance System.Object DynamicClassFactory Inherited Members System.Object.ToString() System.Object.Equals(System.Object) System.Object.Equals(System.Object, System.Object) System.Object.ReferenceEquals(System.Object, System.Object) System.Object.GetHashCode() System.Object.GetType() System.Object.MemberwiseClone() Namespace : System.Linq.Dynamic.Core Assembly : System.Linq.Dynamic.Core.dll Syntax public static class DynamicClassFactory Methods | Improve this Doc View Source CreateGenericComparerType(Type, Type) Create a GenericComparerType based on the GenericType and an instance of a System.Collections.IComparer . Declaration public static Type CreateGenericComparerType(Type comparerGenericType, Type comparerType) Parameters Type Name Description System.Type comparerGenericType The GenericType System.Type comparerType The System.Collections.IComparer instance Returns Type Description System.Type Type | Improve this Doc View Source CreateType(IList, Boolean) The CreateType method creates a new data class with a given set of public properties and returns the System.Type object for the newly created class. If a data class with an identical sequence of properties has already been created, the System.Type object for this class is returned. Data classes implement private instance variables and read/write property accessors for the specified properties.Data classes also override the Equals and GetHashCode members to implement by-value equality. Data classes are created in an in-memory assembly in the current application domain. All data classes inherit from DynamicClass and are given automatically generated names that should be considered private (the names will be unique within the application domain but not across multiple invocations of the application). Note that once created, a data class stays in memory for the lifetime of the current application domain. There is currently no way to unload a dynamically created data class. The dynamic expression parser uses the CreateClass methods to generate classes from data object initializers. This feature in turn is often used with the dynamic Select method to create projections. Declaration public static Type CreateType(IList properties, bool createParameterCtor = true) Parameters Type Name Description System.Collections.Generic.IList < DynamicProperty > properties The DynamicProperties System.Boolean createParameterCtor Create a constructor with parameters. Default set to true. Note that for Linq-to-Database objects, this needs to be set to false. Returns Type Description System.Type Type Examples DynamicProperty[] props = new DynamicProperty[] { new DynamicProperty(\"Name\", typeof(string)), new DynamicProperty(\"Birthday\", typeof(DateTime)) }; Type type = DynamicClassFactory.CreateType(props); DynamicClass dynamicClass = (DynamicClass) Activator.CreateInstance(type)!; dynamicClass.SetDynamicPropertyValue(\"Name\", \"Albert\"); dynamicClass.SetDynamicPropertyValue(\"Birthday\", new DateTime(1879, 3, 14));"
+ },
+ "api/System.Linq.Dynamic.Core.DynamicEnumerableExtensions.html": {
+ "href": "api/System.Linq.Dynamic.Core.DynamicEnumerableExtensions.html",
+ "title": "Class DynamicEnumerableExtensions",
+ "keywords": "Class DynamicEnumerableExtensions Define extensions on System.Collections.IEnumerable . Inheritance System.Object DynamicEnumerableExtensions Inherited Members System.Object.ToString() System.Object.Equals(System.Object) System.Object.Equals(System.Object, System.Object) System.Object.ReferenceEquals(System.Object, System.Object) System.Object.GetHashCode() System.Object.GetType() System.Object.MemberwiseClone() Namespace : System.Linq.Dynamic.Core Assembly : System.Linq.Dynamic.Core.dll Syntax public static class DynamicEnumerableExtensions Methods | Improve this Doc View Source ToDynamicArray(IEnumerable) Creates an array of dynamic objects from a System.Collections.IEnumerable . Declaration public static object[] ToDynamicArray(this IEnumerable source) Parameters Type Name Description System.Collections.IEnumerable source A System.Collections.IEnumerable to create an array from. Returns Type Description System.Object [] An array that contains the elements from the input sequence. | Improve this Doc View Source ToDynamicArray(IEnumerable, Type) Creates an array of dynamic objects from a System.Collections.IEnumerable . Declaration public static object[] ToDynamicArray(this IEnumerable source, Type type) Parameters Type Name Description System.Collections.IEnumerable source A System.Collections.IEnumerable to create an array from. System.Type type A System.Type cast to. Returns Type Description System.Object [] An Array that contains the elements from the input sequence. | Improve this Doc View Source ToDynamicArray(IEnumerable) Creates an array of dynamic objects from a System.Collections.IEnumerable . Declaration public static T[] ToDynamicArray(this IEnumerable source) Parameters Type Name Description System.Collections.IEnumerable source A System.Collections.IEnumerable to create an array from. Returns Type Description T[] An Array{T} that contains the elements from the input sequence. Type Parameters Name Description T The generic type. | Improve this Doc View Source ToDynamicList(IEnumerable) Creates a list of dynamic objects from a System.Collections.IEnumerable . Declaration public static List ToDynamicList(this IEnumerable source) Parameters Type Name Description System.Collections.IEnumerable source A System.Collections.IEnumerable to create an array from. Returns Type Description System.Collections.Generic.List < System.Object > A List that contains the elements from the input sequence. | Improve this Doc View Source ToDynamicList(IEnumerable, Type) Creates a list of dynamic objects from a System.Collections.IEnumerable . Declaration public static List ToDynamicList(this IEnumerable source, Type type) Parameters Type Name Description System.Collections.IEnumerable source A System.Collections.IEnumerable to create an array from. System.Type type A System.Type cast to. Returns Type Description System.Collections.Generic.List < System.Object > A List that contains the elements from the input sequence. | Improve this Doc View Source ToDynamicList(IEnumerable) Creates a list of dynamic objects from a System.Collections.IEnumerable . Declaration public static List ToDynamicList(this IEnumerable source) Parameters Type Name Description System.Collections.IEnumerable source A System.Collections.IEnumerable to create an array from. Returns Type Description System.Collections.Generic.List A List{T} that contains the elements from the input sequence. Type Parameters Name Description T Generic Type"
+ },
+ "api/System.Linq.Dynamic.Core.DynamicExpressionParser.html": {
+ "href": "api/System.Linq.Dynamic.Core.DynamicExpressionParser.html",
+ "title": "Class DynamicExpressionParser",
+ "keywords": "Class DynamicExpressionParser Helper class to convert an expression into an LambdaExpression Inheritance System.Object DynamicExpressionParser Inherited Members System.Object.ToString() System.Object.Equals(System.Object) System.Object.Equals(System.Object, System.Object) System.Object.ReferenceEquals(System.Object, System.Object) System.Object.GetHashCode() System.Object.GetType() System.Object.MemberwiseClone() Namespace : System.Linq.Dynamic.Core Assembly : System.Linq.Dynamic.Core.dll Syntax public static class DynamicExpressionParser Methods | Improve this Doc View Source ParseLambda(Boolean, ParameterExpression[], Type, String, Object[]) Parses an expression into a LambdaExpression. Declaration [PublicAPI] public static LambdaExpression ParseLambda(bool createParameterCtor, ParameterExpression[] parameters, Type resultType, string expression, params object[] values) Parameters Type Name Description System.Boolean createParameterCtor if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. System.Linq.Expressions.ParameterExpression [] parameters A array from ParameterExpressions. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(Boolean, Type, Type, String, Object[]) Parses an expression into a LambdaExpression. Declaration [PublicAPI] public static LambdaExpression ParseLambda(bool createParameterCtor, Type itType, Type resultType, string expression, params object[] values) Parameters Type Name Description System.Boolean createParameterCtor if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. System.Type itType The main type from the dynamic class expression. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(ParsingConfig, Boolean, ParameterExpression[], Type, String, Object[]) Parses an expression into a LambdaExpression. Declaration [PublicAPI] public static LambdaExpression ParseLambda(ParsingConfig parsingConfig, bool createParameterCtor, ParameterExpression[] parameters, Type resultType, string expression, params object[] values) Parameters Type Name Description ParsingConfig parsingConfig The Configuration for the parsing. System.Boolean createParameterCtor if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. System.Linq.Expressions.ParameterExpression [] parameters A array from ParameterExpressions. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(ParsingConfig, Boolean, Type, String, Object[]) Parses an expression into a LambdaExpression. Declaration [PublicAPI] public static LambdaExpression ParseLambda(ParsingConfig parsingConfig, bool createParameterCtor, Type resultType, string expression, params object[] values) Parameters Type Name Description ParsingConfig parsingConfig The Configuration for the parsing. System.Boolean createParameterCtor if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(ParsingConfig, Boolean, Type, Type, String, Object[]) Parses an expression into a LambdaExpression. Declaration [PublicAPI] public static LambdaExpression ParseLambda(ParsingConfig parsingConfig, bool createParameterCtor, Type itType, Type resultType, string expression, params object[] values) Parameters Type Name Description ParsingConfig parsingConfig The Configuration for the parsing. System.Boolean createParameterCtor if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. System.Type itType The main type from the dynamic class expression. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(ParsingConfig, ParameterExpression[], Type, String, Object[]) Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.) Declaration [PublicAPI] public static LambdaExpression ParseLambda(ParsingConfig parsingConfig, ParameterExpression[] parameters, Type resultType, string expression, params object[] values) Parameters Type Name Description ParsingConfig parsingConfig The Configuration for the parsing. System.Linq.Expressions.ParameterExpression [] parameters A array from ParameterExpressions. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(ParsingConfig, Type, String, Object[]) Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.) Declaration [PublicAPI] public static LambdaExpression ParseLambda(ParsingConfig parsingConfig, Type resultType, string expression, params object[] values) Parameters Type Name Description ParsingConfig parsingConfig The Configuration for the parsing. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(ParsingConfig, Type, Type, String, Object[]) Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.) Declaration [PublicAPI] public static LambdaExpression ParseLambda(ParsingConfig parsingConfig, Type itType, Type resultType, string expression, params object[] values) Parameters Type Name Description ParsingConfig parsingConfig The Configuration for the parsing. System.Type itType The main type from the dynamic class expression. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(ParameterExpression[], Type, String, Object[]) Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.) Declaration [PublicAPI] public static LambdaExpression ParseLambda(ParameterExpression[] parameters, Type resultType, string expression, params object[] values) Parameters Type Name Description System.Linq.Expressions.ParameterExpression [] parameters A array from ParameterExpressions. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(Type, ParsingConfig, Boolean, ParameterExpression[], Type, String, Object[]) Parses an expression into a LambdaExpression. Declaration [PublicAPI] public static LambdaExpression ParseLambda(Type delegateType, ParsingConfig parsingConfig, bool createParameterCtor, ParameterExpression[] parameters, Type resultType, string expression, params object[] values) Parameters Type Name Description System.Type delegateType The delegate type. ParsingConfig parsingConfig The Configuration for the parsing. System.Boolean createParameterCtor if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. System.Linq.Expressions.ParameterExpression [] parameters A array from ParameterExpressions. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(Type, ParsingConfig, Boolean, Type, String, Object[]) Parses an expression into a LambdaExpression. Declaration [PublicAPI] public static LambdaExpression ParseLambda(Type delegateType, ParsingConfig parsingConfig, bool createParameterCtor, Type resultType, string expression, params object[] values) Parameters Type Name Description System.Type delegateType The delegate type. ParsingConfig parsingConfig The Configuration for the parsing. System.Boolean createParameterCtor if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(Type, ParsingConfig, Boolean, Type, Type, String, Object[]) Parses an expression into a LambdaExpression. Declaration [PublicAPI] public static LambdaExpression ParseLambda(Type delegateType, ParsingConfig parsingConfig, bool createParameterCtor, Type itType, Type resultType, string expression, params object[] values) Parameters Type Name Description System.Type delegateType The delegate type. ParsingConfig parsingConfig The Configuration for the parsing. System.Boolean createParameterCtor if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. System.Type itType The main type from the dynamic class expression. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(Type, ParsingConfig, ParameterExpression[], Type, String, Object[]) Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.) Declaration [PublicAPI] public static LambdaExpression ParseLambda(Type delegateType, ParsingConfig parsingConfig, ParameterExpression[] parameters, Type resultType, string expression, params object[] values) Parameters Type Name Description System.Type delegateType The delegate type. ParsingConfig parsingConfig The Configuration for the parsing. System.Linq.Expressions.ParameterExpression [] parameters A array from ParameterExpressions. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(Type, ParsingConfig, Type, String, Object[]) Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.) Declaration [PublicAPI] public static LambdaExpression ParseLambda(Type delegateType, ParsingConfig parsingConfig, Type resultType, string expression, params object[] values) Parameters Type Name Description System.Type delegateType The delegate type. ParsingConfig parsingConfig The Configuration for the parsing. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(Type, ParsingConfig, Type, Type, String, Object[]) Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.) Declaration [PublicAPI] public static LambdaExpression ParseLambda(Type delegateType, ParsingConfig parsingConfig, Type itType, Type resultType, string expression, params object[] values) Parameters Type Name Description System.Type delegateType The delegate type. ParsingConfig parsingConfig The Configuration for the parsing. System.Type itType The main type from the dynamic class expression. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(Type, ParameterExpression[], Type, String, Object[]) Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.) Declaration [PublicAPI] public static LambdaExpression ParseLambda(Type delegateType, ParameterExpression[] parameters, Type resultType, string expression, params object[] values) Parameters Type Name Description System.Type delegateType The delegate type. System.Linq.Expressions.ParameterExpression [] parameters A array from ParameterExpressions. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(Type, String, Object[]) Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.) Declaration [PublicAPI] public static LambdaExpression ParseLambda(Type resultType, string expression, params object[] values) Parameters Type Name Description System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(Type, Type, String, Object[]) Parses an expression into a LambdaExpression. (Also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities.) Declaration [PublicAPI] public static LambdaExpression ParseLambda(Type itType, Type resultType, string expression, params object[] values) Parameters Type Name Description System.Type itType The main type from the dynamic class expression. System.Type resultType Type of the result. If not specified, it will be generated dynamically. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.LambdaExpression The generated System.Linq.Expressions.LambdaExpression | Improve this Doc View Source ParseLambda(ParsingConfig, Boolean, ParameterExpression[], String, Object[]) Parses an expression into a Typed Expression. Declaration [PublicAPI] public static Expression> ParseLambda(ParsingConfig parsingConfig, bool createParameterCtor, ParameterExpression[] parameters, string expression, params object[] values) Parameters Type Name Description ParsingConfig parsingConfig The Configuration for the parsing. System.Boolean createParameterCtor if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. System.Linq.Expressions.ParameterExpression [] parameters A array from ParameterExpressions. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.Expression < System.Func > The generated System.Linq.Expressions.Expression Type Parameters Name Description TResult The type of the result. | Improve this Doc View Source ParseLambda(ParsingConfig, Boolean, String, Object[]) Parses an expression into a Typed Expression. Declaration [PublicAPI] public static Expression> ParseLambda(ParsingConfig parsingConfig, bool createParameterCtor, string expression, params object[] values) Parameters Type Name Description ParsingConfig parsingConfig The Configuration for the parsing. System.Boolean createParameterCtor if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.Expression < System.Func > The generated System.Linq.Expressions.Expression Type Parameters Name Description TResult The type of the result. | Improve this Doc View Source ParseLambda(Type, ParsingConfig, Boolean, ParameterExpression[], String, Object[]) Parses an expression into a Typed Expression. Declaration [PublicAPI] public static Expression> ParseLambda(Type delegateType, ParsingConfig parsingConfig, bool createParameterCtor, ParameterExpression[] parameters, string expression, params object[] values) Parameters Type Name Description System.Type delegateType The delegate type. ParsingConfig parsingConfig The Configuration for the parsing. System.Boolean createParameterCtor if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. System.Linq.Expressions.ParameterExpression [] parameters A array from ParameterExpressions. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.Expression < System.Func > The generated System.Linq.Expressions.Expression Type Parameters Name Description TResult The type of the result. | Improve this Doc View Source ParseLambda(Type, ParsingConfig, Boolean, String, Object[]) Parses an expression into a Typed Expression. Declaration [PublicAPI] public static Expression> ParseLambda(Type delegateType, ParsingConfig parsingConfig, bool createParameterCtor, string expression, params object[] values) Parameters Type Name Description System.Type delegateType The delegate type. ParsingConfig parsingConfig The Configuration for the parsing. System.Boolean createParameterCtor if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.Expression < System.Func > The generated System.Linq.Expressions.Expression Type Parameters Name Description TResult The type of the result. | Improve this Doc View Source ParseLambda(ParsingConfig, Boolean, String, Object[]) Parses an expression into a Typed Expression. Declaration [PublicAPI] public static Expression> ParseLambda(ParsingConfig parsingConfig, bool createParameterCtor, string expression, params object[] values) Parameters Type Name Description ParsingConfig parsingConfig The Configuration for the parsing. System.Boolean createParameterCtor if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.Expression < System.Func > The generated System.Linq.Expressions.Expression Type Parameters Name Description T The it -Type. TResult The type of the result. | Improve this Doc View Source ParseLambda(Type, ParsingConfig, Boolean, String, Object[]) Parses an expression into a Typed Expression. Declaration [PublicAPI] public static Expression> ParseLambda(Type delegateType, ParsingConfig parsingConfig, bool createParameterCtor, string expression, params object[] values) Parameters Type Name Description System.Type delegateType The delegate type. ParsingConfig parsingConfig The Configuration for the parsing. System.Boolean createParameterCtor if set to true then also create a constructor for all the parameters. Note that this doesn't work for Linq-to-Database entities. System.String expression The expression. System.Object [] values An object array that contains zero or more objects which are used as replacement values. Returns Type Description System.Linq.Expressions.Expression < System.Func > The generated System.Linq.Expressions.Expression Type Parameters Name Description T The it -Type. TResult The type of the result."
+ },
+ "api/System.Linq.Dynamic.Core.DynamicProperty.html": {
+ "href": "api/System.Linq.Dynamic.Core.DynamicProperty.html",
+ "title": "Class DynamicProperty",
+ "keywords": "Class DynamicProperty DynamicProperty Inheritance System.Object DynamicProperty Inherited Members System.Object.ToString() System.Object.Equals(System.Object) System.Object.Equals(System.Object, System.Object) System.Object.ReferenceEquals(System.Object, System.Object) System.Object.GetHashCode() System.Object.GetType() System.Object.MemberwiseClone() Namespace : System.Linq.Dynamic.Core Assembly : System.Linq.Dynamic.Core.dll Syntax public class DynamicProperty Constructors | Improve this Doc View Source DynamicProperty(String, Type) Initializes a new instance of the DynamicProperty class. Declaration public DynamicProperty(string name, Type type) Parameters Type Name Description System.String name The name from the property. System.Type type The type from the property. Properties | Improve this Doc View Source Name Gets the name from the property. Declaration public string Name { get; } Property Value Type Description System.String The name from the property. | Improve this Doc View Source Type Gets the type from the property. Declaration public Type Type { get; } Property Value Type Description System.Type The type from the property."
+ },
+ "api/System.Linq.Dynamic.Core.DynamicQueryableExtensions.html": {
+ "href": "api/System.Linq.Dynamic.Core.DynamicQueryableExtensions.html",
+ "title": "Class DynamicQueryableExtensions",
+ "keywords": "Class DynamicQueryableExtensions Provides a set of static (Shared in Visual Basic) methods for querying data structures that implement System.Linq.IQueryable . It allows dynamic string based querying. Very handy when, at compile time, you don't know the type of queries that will be generated, or when downstream components only return column names to sort and filter by. Inheritance System.Object DynamicQueryableExtensions Inherited Members System.Object.ToString() System.Object.Equals(System.Object) System.Object.Equals(System.Object, System.Object) System.Object.ReferenceEquals(System.Object, System.Object) System.Object.GetHashCode() System.Object.GetType() System.Object.MemberwiseClone() Namespace : System.Linq.Dynamic.Core Assembly : System.Linq.Dynamic.Core.dll Syntax public static class DynamicQueryableExtensions Methods | Improve this Doc View Source Aggregate(IQueryable, String, String) Dynamically runs an aggregate function on the IQueryable. Declaration public static object Aggregate(this IQueryable source, string function, string member) Parameters Type Name Description System.Linq.IQueryable source The IQueryable data source. System.String function The name of the function to run. Can be Sum, Average, Min or Max. System.String member The name of the property to aggregate over. Returns Type Description System.Object The value of the aggregate function run over the specified property. | Improve this Doc View Source All(IQueryable, ParsingConfig, String, Object[]) Determines whether all the elements of a sequence satisfy a condition. Declaration [PublicAPI] public static bool All(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence whose elements to test for a condition. ParsingConfig config The ParsingConfig . System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Boolean true if every element of the source sequence passes the test in the specified predicate, or if the sequence is empty; otherwise, false. | Improve this Doc View Source All(IQueryable, String, Object[]) Determines whether all the elements of a sequence satisfy a condition. Declaration [PublicAPI] public static bool All(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence whose elements to test for a condition. System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Boolean true if every element of the source sequence passes the test in the specified predicate, or if the sequence is empty; otherwise, false. | Improve this Doc View Source Any(IQueryable) Determines whether a sequence contains any elements. Declaration public static bool Any(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source A sequence to check for being empty. Returns Type Description System.Boolean true if the source sequence contains any elements; otherwise, false. Examples IQueryable queryable = employees.AsQueryable(); var result = queryable.Any(); | Improve this Doc View Source Any(IQueryable, ParsingConfig, String, Object[]) Determines whether a sequence contains any elements. Declaration [PublicAPI] public static bool Any(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence to check for being empty. ParsingConfig config The ParsingConfig . System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Boolean true if the source sequence contains any elements; otherwise, false. Examples IQueryable queryable = employees.AsQueryable(); var result1 = queryable.Any(\"Income > 50\"); var result2 = queryable.Any(\"Income > @0\", 50); var result3 = queryable.Select(\"Roles.Any()\"); | Improve this Doc View Source Any(IQueryable, LambdaExpression) Determines whether a sequence contains any elements. Declaration public static bool Any(this IQueryable source, LambdaExpression lambda) Parameters Type Name Description System.Linq.IQueryable source A sequence to check for being empty. System.Linq.Expressions.LambdaExpression lambda A cached Lambda Expression. Returns Type Description System.Boolean true if the source sequence contains any elements; otherwise, false. | Improve this Doc View Source Any(IQueryable, String, Object[]) Determines whether a sequence contains any elements. Declaration public static bool Any(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Boolean true if the source sequence contains any elements; otherwise, false. | Improve this Doc View Source AsDynamicEnumerable(IQueryable) Returns the input typed as System.Collections.Generic.IEnumerable of System.Object ./> Declaration public static IEnumerable AsDynamicEnumerable(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source The sequence to type as System.Collections.Generic.IEnumerable of System.Object . Returns Type Description System.Collections.Generic.IEnumerable < System.Object > The input typed as System.Collections.Generic.IEnumerable of System.Object . | Improve this Doc View Source Average(IQueryable) Computes the average of a sequence of numeric values. Declaration [PublicAPI] public static double Average(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source A sequence of numeric values to calculate the average of. Returns Type Description System.Double The average of the values in the sequence. Examples IQueryable queryable = employees.AsQueryable(); var result1 = queryable.Average(); var result2 = queryable.Select(\"Roles.Average()\"); | Improve this Doc View Source Average(IQueryable, ParsingConfig, String, Object[]) Computes the average of a sequence of numeric values. Declaration [PublicAPI] public static double Average(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence of numeric values to calculate the average of. ParsingConfig config The ParsingConfig . System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Double The average of the values in the sequence. Examples IQueryable queryable = employees.AsQueryable(); var result = queryable.Average(\"Income\"); | Improve this Doc View Source Average(IQueryable, LambdaExpression) Computes the average of a sequence of numeric values. Declaration [PublicAPI] public static double Average(this IQueryable source, LambdaExpression lambda) Parameters Type Name Description System.Linq.IQueryable source A sequence of numeric values to calculate the average of. System.Linq.Expressions.LambdaExpression lambda A Lambda Expression. Returns Type Description System.Double The average of the values in the sequence. | Improve this Doc View Source Average(IQueryable, String, Object[]) Computes the average of a sequence of numeric values. Declaration [PublicAPI] public static double Average(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Double The average of the values in the sequence. | Improve this Doc View Source Cast(IQueryable, ParsingConfig, String) Converts the elements of an System.Linq.IQueryable to the specified type. Declaration public static IQueryable Cast(this IQueryable source, ParsingConfig config, string typeName) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable that contains the elements to be converted. ParsingConfig config The ParsingConfig . System.String typeName The type to convert the elements of source to. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable that contains each element of the source sequence converted to the specified type. | Improve this Doc View Source Cast(IQueryable, String) Converts the elements of an System.Linq.IQueryable to the specified type. Declaration public static IQueryable Cast(this IQueryable source, string typeName) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable that contains the elements to be converted. System.String typeName The type to convert the elements of source to. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable that contains each element of the source sequence converted to the specified type. | Improve this Doc View Source Cast(IQueryable, Type) Converts the elements of an System.Linq.IQueryable to the specified type. Declaration public static IQueryable Cast(this IQueryable source, Type type) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable that contains the elements to be converted. System.Type type The type to convert the elements of source to. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable that contains each element of the source sequence converted to the specified type. | Improve this Doc View Source Count(IQueryable) Returns the number of elements in a sequence. Declaration public static int Count(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable that contains the elements to be counted. Returns Type Description System.Int32 The number of elements in the input sequence. Examples IQueryable queryable = employees.AsQueryable(); var result = queryable.Count(); | Improve this Doc View Source Count(IQueryable, ParsingConfig, String, Object[]) Returns the number of elements in a sequence. Declaration [PublicAPI] public static int Count(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable that contains the elements to be counted. ParsingConfig config The ParsingConfig . System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Int32 The number of elements in the specified sequence that satisfies a condition. Examples IQueryable queryable = employees.AsQueryable(); var result1 = queryable.Count(\"Income > 50\"); var result2 = queryable.Count(\"Income > @0\", 50); var result3 = queryable.Select(\"Roles.Count()\"); | Improve this Doc View Source Count(IQueryable, LambdaExpression) Returns the number of elements in a sequence. Declaration public static int Count(this IQueryable source, LambdaExpression lambda) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable that contains the elements to be counted. System.Linq.Expressions.LambdaExpression lambda A cached Lambda Expression. Returns Type Description System.Int32 The number of elements in the specified sequence that satisfies a condition. | Improve this Doc View Source Count(IQueryable, String, Object[]) Returns the number of elements in a sequence. Declaration public static int Count(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Int32 The number of elements in the specified sequence that satisfies a condition. | Improve this Doc View Source DefaultIfEmpty(IQueryable) Returns the elements of the specified sequence or the type parameter's default value in a singleton collection if the sequence is empty. Declaration public static IQueryable DefaultIfEmpty(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return a default value for if empty. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable that contains default if source is empty; otherwise, source. Examples IQueryable queryable = employees.DefaultIfEmpty(); | Improve this Doc View Source DefaultIfEmpty(IQueryable, Object) Returns the elements of the specified sequence or the type parameter's default value in a singleton collection if the sequence is empty. Declaration public static IQueryable DefaultIfEmpty(this IQueryable source, object defaultValue) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return a default value for if empty. System.Object defaultValue The value to return if the sequence is empty. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable that contains defaultValue if source is empty; otherwise, source. Examples IQueryable queryable = employees.DefaultIfEmpty(new Employee()); | Improve this Doc View Source Distinct(IQueryable) Returns distinct elements from a sequence by using the default equality comparer to compare values. Declaration public static IQueryable Distinct(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source The sequence to remove duplicate elements from. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable that contains distinct elements from the source sequence. Examples IQueryable queryable = employees.AsQueryable(); var result1 = queryable.Distinct(); var result2 = queryable.Select(\"Roles.Distinct()\"); | Improve this Doc View Source First(IQueryable) Returns the first element of a sequence. Declaration public static object First(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return the first element of. Returns Type Description System.Object The first element in source. | Improve this Doc View Source First(IQueryable, ParsingConfig, String, Object[]) Returns the first element of a sequence that satisfies a specified condition. Declaration [PublicAPI] public static object First(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return the first element of. ParsingConfig config The ParsingConfig . System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Object The first element in source that passes the test in predicate. | Improve this Doc View Source First(IQueryable, LambdaExpression) Returns the first element of a sequence that satisfies a specified condition. Declaration public static object First(this IQueryable source, LambdaExpression lambda) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return the first element of. System.Linq.Expressions.LambdaExpression lambda A cached Lambda Expression. Returns Type Description System.Object The first element in source that passes the test in predicate. | Improve this Doc View Source First(IQueryable, String, Object[]) Returns the first element of a sequence that satisfies a specified condition. Declaration public static object First(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Object The first element in source that passes the test in predicate. | Improve this Doc View Source FirstOrDefault(IQueryable) Returns the first element of a sequence, or a default value if the sequence contains no elements. Declaration public static object FirstOrDefault(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return the first element of. Returns Type Description System.Object default if source is empty; otherwise, the first element in source. | Improve this Doc View Source FirstOrDefault(IQueryable, ParsingConfig, String, Object[]) Returns the first element of a sequence that satisfies a specified condition or a default value if no such element is found. Declaration [PublicAPI] public static object FirstOrDefault(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return the first element of. ParsingConfig config The ParsingConfig . System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Object default if source is empty or if no element passes the test specified by predicate; otherwise, the first element in source that passes the test specified by predicate. | Improve this Doc View Source FirstOrDefault(IQueryable, LambdaExpression) Returns the first element of a sequence that satisfies a specified condition or a default value if no such element is found. Declaration public static object FirstOrDefault(this IQueryable source, LambdaExpression lambda) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return the first element of. System.Linq.Expressions.LambdaExpression lambda A cached Lambda Expression. Returns Type Description System.Object default if source is empty or if no element passes the test specified by predicate; otherwise, the first element in source that passes the test specified by predicate. | Improve this Doc View Source FirstOrDefault(IQueryable, String, Object[]) Returns the first element of a sequence that satisfies a specified condition or a default value if no such element is found. Declaration public static object FirstOrDefault(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Object default if source is empty or if no element passes the test specified by predicate; otherwise, the first element in source that passes the test specified by predicate. | Improve this Doc View Source GroupBy(IQueryable, ParsingConfig, String, IEqualityComparer, Object[]) Groups the elements of a sequence according to a specified key string function and creates a result value from each group and its key. Declaration public static IQueryable GroupBy(this IQueryable source, ParsingConfig config, string keySelector, IEqualityComparer equalityComparer, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A System.Linq.IQueryable whose elements to group. ParsingConfig config The ParsingConfig . System.String keySelector A string expression to specify the key for each element. System.Collections.IEqualityComparer equalityComparer The comparer to use. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable where each element represents a projection over a group and its key. | Improve this Doc View Source GroupBy(IQueryable, ParsingConfig, String, Object[]) Groups the elements of a sequence according to a specified key string function and creates a result value from each group and its key. Declaration [PublicAPI] public static IQueryable GroupBy(this IQueryable source, ParsingConfig config, string keySelector, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A System.Linq.IQueryable whose elements to group. ParsingConfig config The ParsingConfig . System.String keySelector A string expression to specify the key for each element. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable where each element represents a projection over a group and its key. Examples var groupResult1 = queryable.GroupBy(\"NumberPropertyAsKey\"); var groupResult2 = queryable.GroupBy(\"new (NumberPropertyAsKey, StringPropertyAsKey)\"); | Improve this Doc View Source GroupBy(IQueryable, ParsingConfig, String, String) Groups the elements of a sequence according to a specified key string function and creates a result value from each group and its key. Declaration public static IQueryable GroupBy(this IQueryable source, ParsingConfig config, string keySelector, string resultSelector) Parameters Type Name Description System.Linq.IQueryable source A System.Linq.IQueryable whose elements to group. ParsingConfig config The ParsingConfig . System.String keySelector A string expression to specify the key for each element. System.String resultSelector A string expression to specify a result value from each group. Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable where each element represents a projection over a group and its key. Examples var groupResult1 = queryable.GroupBy(\"NumberPropertyAsKey\", \"StringProperty\"); var groupResult2 = queryable.GroupBy(\"new (NumberPropertyAsKey, StringPropertyAsKey)\", \"new (StringProperty1, StringProperty2)\"); | Improve this Doc View Source GroupBy(IQueryable, ParsingConfig, String, String, IEqualityComparer) Groups the elements of a sequence according to a specified key string function and creates a result value from each group and its key. Declaration public static IQueryable GroupBy(this IQueryable source, ParsingConfig config, string keySelector, string resultSelector, IEqualityComparer equalityComparer) Parameters Type Name Description System.Linq.IQueryable source A System.Linq.IQueryable whose elements to group. ParsingConfig config The ParsingConfig . System.String keySelector A string expression to specify the key for each element. System.String resultSelector A string expression to specify a result value from each group. System.Collections.IEqualityComparer equalityComparer The comparer to use. Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable where each element represents a projection over a group and its key. | Improve this Doc View Source GroupBy(IQueryable, ParsingConfig, String, String, IEqualityComparer, Object[]) Groups the elements of a sequence according to a specified key string function and creates a result value from each group and its key. Declaration public static IQueryable GroupBy(this IQueryable source, ParsingConfig config, string keySelector, string resultSelector, IEqualityComparer equalityComparer, object[] args) Parameters Type Name Description System.Linq.IQueryable source A System.Linq.IQueryable whose elements to group. ParsingConfig config The ParsingConfig . System.String keySelector A string expression to specify the key for each element. System.String resultSelector A string expression to specify a result value from each group. System.Collections.IEqualityComparer equalityComparer The comparer to use. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable where each element represents a projection over a group and its key. | Improve this Doc View Source GroupBy(IQueryable, ParsingConfig, String, String, Object[]) Groups the elements of a sequence according to a specified key string function and creates a result value from each group and its key. Declaration [PublicAPI] public static IQueryable GroupBy(this IQueryable source, ParsingConfig config, string keySelector, string resultSelector, object[] args) Parameters Type Name Description System.Linq.IQueryable source A System.Linq.IQueryable whose elements to group. ParsingConfig config The ParsingConfig . System.String keySelector A string expression to specify the key for each element. System.String resultSelector A string expression to specify a result value from each group. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable where each element represents a projection over a group and its key. Examples var groupResult1 = queryable.GroupBy(\"NumberPropertyAsKey\", \"StringProperty\"); var groupResult2 = queryable.GroupBy(\"new (NumberPropertyAsKey, StringPropertyAsKey)\", \"new (StringProperty1, StringProperty2)\"); | Improve this Doc View Source GroupBy(IQueryable, String, IEqualityComparer, Object[]) Groups the elements of a sequence according to a specified key string function and creates a result value from each group and its key. Declaration public static IQueryable GroupBy(this IQueryable source, string keySelector, IEqualityComparer equalityComparer, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String keySelector System.Collections.IEqualityComparer equalityComparer System.Object [] args Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable where each element represents a projection over a group and its key. | Improve this Doc View Source GroupBy(IQueryable, String, Object[]) Groups the elements of a sequence according to a specified key string function and creates a result value from each group and its key. Declaration [PublicAPI] public static IQueryable GroupBy(this IQueryable source, string keySelector, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String keySelector System.Object [] args Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable where each element represents a projection over a group and its key. | Improve this Doc View Source GroupBy(IQueryable, String, String) Groups the elements of a sequence according to a specified key string function and creates a result value from each group and its key. Declaration public static IQueryable GroupBy(this IQueryable source, string keySelector, string resultSelector) Parameters Type Name Description System.Linq.IQueryable source System.String keySelector System.String resultSelector Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable where each element represents a projection over a group and its key. | Improve this Doc View Source GroupBy(IQueryable, String, String, IEqualityComparer) Groups the elements of a sequence according to a specified key string function and creates a result value from each group and its key. Declaration public static IQueryable GroupBy(this IQueryable source, string keySelector, string resultSelector, IEqualityComparer equalityComparer) Parameters Type Name Description System.Linq.IQueryable source System.String keySelector System.String resultSelector System.Collections.IEqualityComparer equalityComparer Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable where each element represents a projection over a group and its key. | Improve this Doc View Source GroupBy(IQueryable, String, String, IEqualityComparer, Object[]) Groups the elements of a sequence according to a specified key string function and creates a result value from each group and its key. Declaration public static IQueryable GroupBy(this IQueryable source, string keySelector, string resultSelector, IEqualityComparer equalityComparer, object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String keySelector System.String resultSelector System.Collections.IEqualityComparer equalityComparer System.Object [] args Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable where each element represents a projection over a group and its key. | Improve this Doc View Source GroupBy(IQueryable, String, String, Object[]) Groups the elements of a sequence according to a specified key string function and creates a result value from each group and its key. Declaration [PublicAPI] public static IQueryable GroupBy(this IQueryable source, string keySelector, string resultSelector, object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String keySelector System.String resultSelector System.Object [] args Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable where each element represents a projection over a group and its key. | Improve this Doc View Source GroupByMany(IEnumerable, Func[]) Groups the elements of a sequence according to multiple specified key functions and creates a result value from each group (and subgroups) and its key. Declaration public static IEnumerable GroupByMany(this IEnumerable source, params Func[] keySelectors) Parameters Type Name Description System.Collections.Generic.IEnumerable source A System.Collections.Generic.IEnumerable whose elements to group. System.Func [] keySelectors Lambda expressions to specify the keys for each element. Returns Type Description System.Collections.Generic.IEnumerable < GroupResult > A System.Collections.Generic.IEnumerable of type GroupResult where each element represents a projection over a group, its key, and its subgroups. Type Parameters Name Description TElement | Improve this Doc View Source GroupByMany(IEnumerable, ParsingConfig, String[]) Groups the elements of a sequence according to multiple specified key string functions and creates a result value from each group (and subgroups) and its key. Declaration public static IEnumerable GroupByMany(this IEnumerable source, ParsingConfig config, params string[] keySelectors) Parameters Type Name Description System.Collections.Generic.IEnumerable source A System.Collections.Generic.IEnumerable whose elements to group. ParsingConfig config The ParsingConfig . System.String [] keySelectors System.String expressions to specify the keys for each element. Returns Type Description System.Collections.Generic.IEnumerable < GroupResult > A System.Collections.Generic.IEnumerable of type GroupResult where each element represents a projection over a group, its key, and its subgroups. Type Parameters Name Description TElement | Improve this Doc View Source GroupByMany(IEnumerable, String[]) Groups the elements of a sequence according to multiple specified key string functions and creates a result value from each group (and subgroups) and its key. Declaration public static IEnumerable GroupByMany(this IEnumerable source, params string[] keySelectors) Parameters Type Name Description System.Collections.Generic.IEnumerable source System.String [] keySelectors Returns Type Description System.Collections.Generic.IEnumerable < GroupResult > A System.Collections.Generic.IEnumerable of type GroupResult where each element represents a projection over a group, its key, and its subgroups. Type Parameters Name Description TElement | Improve this Doc View Source GroupJoin(IQueryable, IEnumerable, String, String, String, Object[]) Correlates the elements of two sequences based on equality of keys and groups the results. The default equality comparer is used to compare keys. Declaration public static IQueryable GroupJoin(this IQueryable outer, IEnumerable inner, string outerKeySelector, string innerKeySelector, string resultSelector, params object[] args) Parameters Type Name Description System.Linq.IQueryable outer System.Collections.IEnumerable inner System.String outerKeySelector System.String innerKeySelector System.String resultSelector System.Object [] args Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable obtained by performing a grouped join on two sequences. | Improve this Doc View Source GroupJoin(IQueryable, ParsingConfig, IEnumerable, String, String, String, Object[]) Correlates the elements of two sequences based on equality of keys and groups the results. The default equality comparer is used to compare keys. Declaration public static IQueryable GroupJoin(this IQueryable outer, ParsingConfig config, IEnumerable inner, string outerKeySelector, string innerKeySelector, string resultSelector, params object[] args) Parameters Type Name Description System.Linq.IQueryable outer The first sequence to join. ParsingConfig config The ParsingConfig . System.Collections.IEnumerable inner The sequence to join to the first sequence. System.String outerKeySelector A dynamic function to extract the join key from each element of the first sequence. System.String innerKeySelector A dynamic function to extract the join key from each element of the second sequence. System.String resultSelector A dynamic function to create a result element from an element from the first sequence and a collection of matching elements from the second sequence. System.Object [] args An object array that contains zero or more objects to insert into the predicates as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable obtained by performing a grouped join on two sequences. | Improve this Doc View Source Join(IQueryable, IEnumerable, String, String, String, Object[]) Correlates the elements of two sequences based on matching keys. The default equality comparer is used to compare keys. Declaration public static IQueryable Join(this IQueryable outer, IEnumerable inner, string outerKeySelector, string innerKeySelector, string resultSelector, params object[] args) Parameters Type Name Description System.Linq.IQueryable outer System.Collections.IEnumerable inner System.String outerKeySelector System.String innerKeySelector System.String resultSelector System.Object [] args Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable obtained by performing an inner join on two sequences. | Improve this Doc View Source Join(IQueryable, ParsingConfig, IEnumerable, String, String, String, Object[]) Correlates the elements of two sequences based on matching keys. The default equality comparer is used to compare keys. Declaration public static IQueryable Join(this IQueryable outer, ParsingConfig config, IEnumerable inner, string outerKeySelector, string innerKeySelector, string resultSelector, params object[] args) Parameters Type Name Description System.Linq.IQueryable outer The first sequence to join. ParsingConfig config The ParsingConfig . System.Collections.IEnumerable inner The sequence to join to the first sequence. System.String outerKeySelector A dynamic function to extract the join key from each element of the first sequence. System.String innerKeySelector A dynamic function to extract the join key from each element of the second sequence. System.String resultSelector A dynamic function to create a result element from two matching elements. System.Object [] args An object array that contains zero or more objects to insert into the predicates as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable obtained by performing an inner join on two sequences. | Improve this Doc View Source Join(IQueryable, IEnumerable, String, String, String, Object[]) Correlates the elements of two sequences based on matching keys. The default equality comparer is used to compare keys. Declaration public static IQueryable Join(this IQueryable outer, IEnumerable inner, string outerKeySelector, string innerKeySelector, string resultSelector, params object[] args) Parameters Type Name Description System.Linq.IQueryable outer System.Collections.Generic.IEnumerable inner System.String outerKeySelector System.String innerKeySelector System.String resultSelector System.Object [] args Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable that has elements of type TResult obtained by performing an inner join on two sequences. Type Parameters Name Description TElement The type of the elements of both sequences, and the result. Remarks This overload only works on elements where both sequences and the resulting element match. | Improve this Doc View Source Join(IQueryable, ParsingConfig, IEnumerable, String, String, String, Object[]) Correlates the elements of two sequences based on matching keys. The default equality comparer is used to compare keys. Declaration public static IQueryable Join(this IQueryable outer, ParsingConfig config, IEnumerable inner, string outerKeySelector, string innerKeySelector, string resultSelector, params object[] args) Parameters Type Name Description System.Linq.IQueryable outer The first sequence to join. ParsingConfig config The ParsingConfig . System.Collections.Generic.IEnumerable inner The sequence to join to the first sequence. System.String outerKeySelector A dynamic function to extract the join key from each element of the first sequence. System.String innerKeySelector A dynamic function to extract the join key from each element of the second sequence. System.String resultSelector A dynamic function to create a result element from two matching elements. System.Object [] args An object array that contains zero or more objects to insert into the predicates as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable that has elements of type TResult obtained by performing an inner join on two sequences. Type Parameters Name Description TElement The type of the elements of both sequences, and the result. Remarks This overload only works on elements where both sequences and the resulting element match. | Improve this Doc View Source Last(IQueryable) Returns the last element of a sequence. Declaration public static object Last(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return the last element of. Returns Type Description System.Object The last element in source. | Improve this Doc View Source Last(IQueryable, ParsingConfig, String, Object[]) Returns the last element of a sequence that satisfies a specified condition. Declaration public static object Last(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return the last element of. ParsingConfig config The ParsingConfig . System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Object The first element in source that passes the test in predicate. | Improve this Doc View Source Last(IQueryable, LambdaExpression) Returns the last element of a sequence that satisfies a specified condition. Declaration public static object Last(this IQueryable source, LambdaExpression lambda) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return the last element of. System.Linq.Expressions.LambdaExpression lambda A cached Lambda Expression. Returns Type Description System.Object The first element in source that passes the test in predicate. | Improve this Doc View Source Last(IQueryable, String, Object[]) Returns the last element of a sequence that satisfies a specified condition. Declaration public static object Last(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Object The first element in source that passes the test in predicate. | Improve this Doc View Source LastOrDefault(IQueryable) Returns the last element of a sequence, or a default value if the sequence contains no elements. Declaration public static object LastOrDefault(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return the last element of. Returns Type Description System.Object default if source is empty; otherwise, the last element in source. | Improve this Doc View Source LastOrDefault(IQueryable, ParsingConfig, String, Object[]) Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements. Declaration public static object LastOrDefault(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return the last element of. ParsingConfig config The ParsingConfig . System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Object The first element in source that passes the test in predicate. | Improve this Doc View Source LastOrDefault(IQueryable, LambdaExpression) Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements. Declaration public static object LastOrDefault(this IQueryable source, LambdaExpression lambda) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return the last element of. System.Linq.Expressions.LambdaExpression lambda A cached Lambda Expression. Returns Type Description System.Object The first element in source that passes the test in predicate. | Improve this Doc View Source LastOrDefault(IQueryable, String, Object[]) Returns the last element of a sequence that satisfies a specified condition, or a default value if the sequence contains no elements. Declaration public static object LastOrDefault(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Object The first element in source that passes the test in predicate. | Improve this Doc View Source LongCount(IQueryable) Returns the number of elements in a sequence. Declaration public static long LongCount(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable that contains the elements to be counted. Returns Type Description System.Int64 The number of elements in the input sequence. Examples IQueryable queryable = employees.AsQueryable(); var result = queryable.LongCount(); | Improve this Doc View Source LongCount(IQueryable, ParsingConfig, String, Object[]) Returns the number of elements in a sequence. Declaration [PublicAPI] public static long LongCount(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable that contains the elements to be counted. ParsingConfig config The ParsingConfig . System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Int64 The number of elements in the specified sequence that satisfies a condition. Examples IQueryable queryable = employees.AsQueryable(); var result1 = queryable.LongCount(\"Income > 50\"); var result2 = queryable.LongCount(\"Income > @0\", 50); var result3 = queryable.Select(\"Roles.LongCount()\"); | Improve this Doc View Source LongCount(IQueryable, LambdaExpression) Returns the number of elements in a sequence. Declaration public static long LongCount(this IQueryable source, LambdaExpression lambda) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable that contains the elements to be counted. System.Linq.Expressions.LambdaExpression lambda A cached Lambda Expression. Returns Type Description System.Int64 The number of elements in the specified sequence that satisfies a condition. | Improve this Doc View Source LongCount(IQueryable, String, Object[]) Returns the number of elements in a sequence. Declaration public static long LongCount(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Int64 The number of elements in the specified sequence that satisfies a condition. | Improve this Doc View Source Max(IQueryable) Computes the max element of a sequence. Declaration [PublicAPI] public static object Max(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to calculate find the max for. Returns Type Description System.Object The max element in the sequence. Examples IQueryable queryable = employees.AsQueryable(); var result1 = queryable.Max(); var result2 = queryable.Select(\"Roles.Max()\"); | Improve this Doc View Source Max(IQueryable, ParsingConfig, String, Object[]) Computes the max element of a sequence. Declaration [PublicAPI] public static object Max(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to calculate find the max for. ParsingConfig config The ParsingConfig . System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Object The max element in the sequence. Examples IQueryable queryable = employees.AsQueryable(); var result = queryable.Max(\"Income\"); | Improve this Doc View Source Max(IQueryable, LambdaExpression) Computes the max element of a sequence. Declaration [PublicAPI] public static object Max(this IQueryable source, LambdaExpression lambda) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to calculate find the max for. System.Linq.Expressions.LambdaExpression lambda A Lambda Expression. Returns Type Description System.Object The max element in the sequence. | Improve this Doc View Source Max(IQueryable, String, Object[]) Computes the max element of a sequence. Declaration [PublicAPI] public static object Max(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Object The max element in the sequence. | Improve this Doc View Source Min(IQueryable) Computes the min element of a sequence. Declaration [PublicAPI] public static object Min(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to calculate find the min for. Returns Type Description System.Object The min element in the sequence. Examples IQueryable queryable = employees.AsQueryable(); var result1 = queryable.Min(); var result2 = queryable.Select(\"Roles.Min()\"); | Improve this Doc View Source Min(IQueryable, ParsingConfig, String, Object[]) Computes the min element of a sequence. Declaration [PublicAPI] public static object Min(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to calculate find the min for. ParsingConfig config The ParsingConfig . System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Object The min element in the sequence. Examples IQueryable queryable = employees.AsQueryable(); var result = queryable.Min(\"Income\"); | Improve this Doc View Source Min(IQueryable, LambdaExpression) Computes the min element of a sequence. Declaration [PublicAPI] public static object Min(this IQueryable source, LambdaExpression lambda) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to calculate find the min for. System.Linq.Expressions.LambdaExpression lambda A Lambda Expression. Returns Type Description System.Object The min element in the sequence. | Improve this Doc View Source Min(IQueryable, String, Object[]) Computes the min element of a sequence. Declaration [PublicAPI] public static object Min(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Object The min element in the sequence. | Improve this Doc View Source OfType(IQueryable, ParsingConfig, String) Filters the elements of an System.Linq.IQueryable based on a specified type. Declaration public static IQueryable OfType(this IQueryable source, ParsingConfig config, string typeName) Parameters Type Name Description System.Linq.IQueryable source An System.Linq.IQueryable whose elements to filter. ParsingConfig config The ParsingConfig . System.String typeName The type to filter the elements of the sequence on. Returns Type Description System.Linq.IQueryable A collection that contains the elements from source that have the type. | Improve this Doc View Source OfType(IQueryable, String) Filters the elements of an System.Linq.IQueryable based on a specified type. Declaration public static IQueryable OfType(this IQueryable source, string typeName) Parameters Type Name Description System.Linq.IQueryable source An System.Linq.IQueryable whose elements to filter. System.String typeName The type to filter the elements of the sequence on. Returns Type Description System.Linq.IQueryable A collection that contains the elements from source that have the type. | Improve this Doc View Source OfType(IQueryable, Type) Filters the elements of an System.Linq.IQueryable based on a specified type. Declaration public static IQueryable OfType(this IQueryable source, Type type) Parameters Type Name Description System.Linq.IQueryable source An System.Linq.IQueryable whose elements to filter. System.Type type The type to filter the elements of the sequence on. Returns Type Description System.Linq.IQueryable A collection that contains the elements from source that have the type. | Improve this Doc View Source OrderBy(IQueryable, ParsingConfig, String, IComparer, Object[]) Sorts the elements of a sequence in ascending or descending order according to a key. Declaration public static IOrderedQueryable OrderBy(this IQueryable source, ParsingConfig config, string ordering, IComparer comparer, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to order. ParsingConfig config The ParsingConfig . System.String ordering An expression string to indicate values to order by. System.Collections.IComparer comparer The comparer to use. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IOrderedQueryable A System.Linq.IQueryable whose elements are sorted according to the specified ordering . | Improve this Doc View Source OrderBy(IQueryable, ParsingConfig, String, Object[]) Sorts the elements of a sequence in ascending or descending order according to a key. Declaration public static IOrderedQueryable OrderBy(this IQueryable source, ParsingConfig config, string ordering, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to order. ParsingConfig config The ParsingConfig . System.String ordering An expression string to indicate values to order by. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IOrderedQueryable A System.Linq.IQueryable whose elements are sorted according to the specified ordering . Examples var resultSingle = queryable.OrderBy(\"NumberProperty\"); var resultSingleDescending = queryable.OrderBy(\"NumberProperty DESC\"); var resultMultiple = queryable.OrderBy(\"NumberProperty, StringProperty DESC\"); | Improve this Doc View Source OrderBy(IQueryable, String, IComparer, Object[]) Sorts the elements of a sequence in ascending or descending order according to a key. Declaration public static IOrderedQueryable OrderBy(this IQueryable source, string ordering, IComparer comparer, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String ordering System.Collections.IComparer comparer System.Object [] args Returns Type Description System.Linq.IOrderedQueryable A System.Linq.IQueryable whose elements are sorted according to the specified ordering . | Improve this Doc View Source OrderBy(IQueryable, String, Object[]) Sorts the elements of a sequence in ascending or descending order according to a key. Declaration public static IOrderedQueryable OrderBy(this IQueryable source, string ordering, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String ordering System.Object [] args Returns Type Description System.Linq.IOrderedQueryable A System.Linq.IQueryable whose elements are sorted according to the specified ordering . | Improve this Doc View Source OrderBy(IQueryable, ParsingConfig, String, IComparer, Object[]) Sorts the elements of a sequence in ascending or descending order according to a key. Declaration public static IOrderedQueryable OrderBy(this IQueryable source, ParsingConfig config, string ordering, IComparer comparer, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to order. ParsingConfig config The ParsingConfig . System.String ordering An expression string to indicate values to order by. System.Collections.IComparer comparer The comparer to use. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IOrderedQueryable A System.Linq.IQueryable whose elements are sorted according to the specified ordering . Type Parameters Name Description TSource The type of the elements of source. | Improve this Doc View Source OrderBy(IQueryable, ParsingConfig, String, Object[]) Sorts the elements of a sequence in ascending or descending order according to a key. Declaration public static IOrderedQueryable OrderBy(this IQueryable source, ParsingConfig config, string ordering, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to order. ParsingConfig config The ParsingConfig . System.String ordering An expression string to indicate values to order by. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IOrderedQueryable A System.Linq.IQueryable whose elements are sorted according to the specified ordering . Type Parameters Name Description TSource The type of the elements of source. Examples var resultSingle = queryable.OrderBy(\"NumberProperty\"); var resultSingleDescending = queryable.OrderBy(\"NumberProperty DESC\"); var resultMultiple = queryable.OrderBy(\"NumberProperty, StringProperty\"); | Improve this Doc View Source OrderBy(IQueryable, String, IComparer, Object[]) Sorts the elements of a sequence in ascending or descending order according to a key. Declaration public static IOrderedQueryable OrderBy(this IQueryable source, string ordering, IComparer comparer, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to order. System.String ordering An expression string to indicate values to order by. System.Collections.IComparer comparer The comparer to use. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IOrderedQueryable A System.Linq.IQueryable whose elements are sorted according to the specified ordering . Type Parameters Name Description TSource The type of the elements of source. | Improve this Doc View Source OrderBy(IQueryable, String, Object[]) Sorts the elements of a sequence in ascending or descending order according to a key. Declaration public static IOrderedQueryable OrderBy(this IQueryable source, string ordering, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String ordering System.Object [] args Returns Type Description System.Linq.IOrderedQueryable A System.Linq.IQueryable whose elements are sorted according to the specified ordering . Type Parameters Name Description TSource The type of the elements of source. | Improve this Doc View Source Page(IQueryable, Int32, Int32) Returns the elements as paged. Declaration public static IQueryable Page(this IQueryable source, int page, int pageSize) Parameters Type Name Description System.Linq.IQueryable source The IQueryable to return elements from. System.Int32 page The page to return. System.Int32 pageSize The number of elements per page. Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable that contains the paged elements. | Improve this Doc View Source Page(IQueryable, Int32, Int32) Returns the elements as paged. Declaration public static IQueryable Page(this IQueryable source, int page, int pageSize) Parameters Type Name Description System.Linq.IQueryable source The IQueryable to return elements from. System.Int32 page The page to return. System.Int32 pageSize The number of elements per page. Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable that contains the paged elements. Type Parameters Name Description TSource The type of the source. | Improve this Doc View Source PageResult(IQueryable, Int32, Int32, Nullable) Returns the elements as paged and include the CurrentPage, PageCount, PageSize and RowCount. Declaration public static PagedResult PageResult(this IQueryable source, int page, int pageSize, int? rowCount = null) Parameters Type Name Description System.Linq.IQueryable source The IQueryable to return elements from. System.Int32 page The page to return. System.Int32 pageSize The number of elements per page. System.Nullable < System.Int32 > rowCount If this optional parameter has been defined, this value is used as the RowCount instead of executing a Linq Count() . Returns Type Description PagedResult PagedResult | Improve this Doc View Source PageResult(IQueryable, Int32, Int32, Nullable) Returns the elements as paged and include the CurrentPage, PageCount, PageSize and RowCount. Declaration public static PagedResult PageResult(this IQueryable source, int page, int pageSize, int? rowCount = null) Parameters Type Name Description System.Linq.IQueryable source The IQueryable to return elements from. System.Int32 page The page to return. System.Int32 pageSize The number of elements per page. System.Nullable < System.Int32 > rowCount If this optional parameter has been defined, this value is used as the RowCount instead of executing a Linq Count() . Returns Type Description PagedResult PagedResult{TSource} Type Parameters Name Description TSource The type of the source. | Improve this Doc View Source Reverse(IQueryable) Inverts the order of the elements in a sequence. Declaration public static IQueryable Reverse(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to reverse. Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable whose elements correspond to those of the input sequence in reverse order. | Improve this Doc View Source Select(IQueryable, ParsingConfig, String, Object[]) Projects each element of a sequence into a new form. Declaration public static IQueryable Select(this IQueryable source, ParsingConfig config, string selector, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to project. ParsingConfig config The ParsingConfig . System.String selector A projection string expression to apply to each element. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable whose elements are the result of invoking a projection string on each element of source. Examples var singleField = queryable.Select(\"StringProperty\"); var dynamicObject = queryable.Select(\"new (StringProperty1, StringProperty2 as OtherStringPropertyName)\"); | Improve this Doc View Source Select(IQueryable, ParsingConfig, Type, String, Object[]) Projects each element of a sequence into a new class of type TResult. Details see http://solutionizing.net/category/linq/ Declaration public static IQueryable Select(this IQueryable source, ParsingConfig config, Type resultType, string selector, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to project. ParsingConfig config The ParsingConfig . System.Type resultType The result type. System.String selector A projection string expression to apply to each element. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable whose elements are the result of invoking a projection string on each element of source. Examples var users = queryable.Select(typeof(User), \"new (Username, Pwd as Password)\"); | Improve this Doc View Source Select(IQueryable, String, Object[]) Projects each element of a sequence into a new form. Declaration public static IQueryable Select(this IQueryable source, string selector, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String selector System.Object [] args Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable whose elements are the result of invoking a projection string on each element of source. | Improve this Doc View Source Select(IQueryable, Type, String, Object[]) Projects each element of a sequence into a new class of type TResult. Details see http://solutionizing.net/category/linq/ Declaration public static IQueryable Select(this IQueryable source, Type resultType, string selector, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.Type resultType System.String selector System.Object [] args Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable whose elements are the result of invoking a projection string on each element of source. | Improve this Doc View Source Select(IQueryable, ParsingConfig, String, Object[]) Projects each element of a sequence into a new class of type TResult. Details see http://solutionizing.net/category/linq/ . Declaration public static IQueryable Select(this IQueryable source, ParsingConfig config, string selector, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to project. ParsingConfig config The ParsingConfig . System.String selector A projection string expression to apply to each element. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable whose elements are the result of invoking a projection string on each element of source. Type Parameters Name Description TResult The type of the result. Examples var users = queryable.Select(\"new (Username, Pwd as Password)\"); | Improve this Doc View Source Select(IQueryable, String, Object[]) Projects each element of a sequence into a new class of type TResult. Details see http://solutionizing.net/category/linq/ . Declaration public static IQueryable Select(this IQueryable source, string selector, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String selector System.Object [] args Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable whose elements are the result of invoking a projection string on each element of source. Type Parameters Name Description TResult The type of the result. | Improve this Doc View Source SelectMany(IQueryable, ParsingConfig, String, Object[]) Projects each element of a sequence to an System.Linq.IQueryable and combines the resulting sequences into one sequence. Declaration public static IQueryable SelectMany(this IQueryable source, ParsingConfig config, string selector, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to project. ParsingConfig config The ParsingConfig . System.String selector A projection string expression to apply to each element. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable whose elements are the result of invoking a one-to-many projection function on each element of the input sequence. Examples var roles = users.SelectMany(\"Roles\"); | Improve this Doc View Source SelectMany(IQueryable, ParsingConfig, String, String, Object[], Object[]) Projects each element of a sequence to an System.Linq.IQueryable and invokes a result selector function on each element therein. The resulting values from each intermediate sequence are combined into a single, one-dimensional sequence and returned. Declaration public static IQueryable SelectMany(this IQueryable source, ParsingConfig config, string collectionSelector, string resultSelector, object[] collectionSelectorArgs = null, params object[] resultSelectorArgs) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to project. ParsingConfig config The ParsingConfig . System.String collectionSelector A projection function to apply to each element of the input sequence. System.String resultSelector A projection function to apply to each element of each intermediate sequence. Should only use x and y as parameter names. System.Object [] collectionSelectorArgs An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. System.Object [] resultSelectorArgs An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable whose elements are the result of invoking the one-to-many projection function collectionSelector on each element of source and then mapping each of those sequence elements and their corresponding source element to a result element. Examples // TODO | Improve this Doc View Source SelectMany(IQueryable, ParsingConfig, String, String, String, String, Object[], Object[]) Projects each element of a sequence to an System.Linq.IQueryable and invokes a result selector function on each element therein. The resulting values from each intermediate sequence are combined into a single, one-dimensional sequence and returned. Declaration public static IQueryable SelectMany(this IQueryable source, ParsingConfig config, string collectionSelector, string resultSelector, string collectionParameterName, string resultParameterName, object[] collectionSelectorArgs = null, params object[] resultSelectorArgs) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to project. ParsingConfig config The ParsingConfig . System.String collectionSelector A projection function to apply to each element of the input sequence. System.String resultSelector A projection function to apply to each element of each intermediate sequence. System.String collectionParameterName The name from collectionParameter to use. Default is x. System.String resultParameterName The name from resultParameterName to use. Default is y. System.Object [] collectionSelectorArgs An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. System.Object [] resultSelectorArgs An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable whose elements are the result of invoking the one-to-many projection function collectionSelector on each element of source and then mapping each of those sequence elements and their corresponding source element to a result element. Examples // TODO | Improve this Doc View Source SelectMany(IQueryable, ParsingConfig, Type, String, Object[]) Projects each element of a sequence to an System.Linq.IQueryable and combines the resulting sequences into one sequence. Declaration public static IQueryable SelectMany(this IQueryable source, ParsingConfig config, Type resultType, string selector, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to project. ParsingConfig config The ParsingConfig . System.Type resultType The result type. System.String selector A projection string expression to apply to each element. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable whose elements are the result of invoking a one-to-many projection function on each element of the input sequence. Examples var permissions = users.SelectMany(typeof(Permission), \"Roles.SelectMany(Permissions)\"); | Improve this Doc View Source SelectMany(IQueryable, String, Object[]) Projects each element of a sequence to an System.Linq.IQueryable and combines the resulting sequences into one sequence. Declaration public static IQueryable SelectMany(this IQueryable source, string selector, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String selector System.Object [] args Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable whose elements are the result of invoking a one-to-many projection function on each element of the input sequence. | Improve this Doc View Source SelectMany(IQueryable, String, String, Object[], Object[]) Projects each element of a sequence to an System.Linq.IQueryable and invokes a result selector function on each element therein. The resulting values from each intermediate sequence are combined into a single, one-dimensional sequence and returned. Declaration public static IQueryable SelectMany(this IQueryable source, string collectionSelector, string resultSelector, object[] collectionSelectorArgs = null, params object[] resultSelectorArgs) Parameters Type Name Description System.Linq.IQueryable source System.String collectionSelector System.String resultSelector System.Object [] collectionSelectorArgs System.Object [] resultSelectorArgs Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable whose elements are the result of invoking the one-to-many projection function collectionSelector on each element of source and then mapping each of those sequence elements and their corresponding source element to a result element. | Improve this Doc View Source SelectMany(IQueryable, String, String, String, String, Object[], Object[]) Projects each element of a sequence to an System.Linq.IQueryable and invokes a result selector function on each element therein. The resulting values from each intermediate sequence are combined into a single, one-dimensional sequence and returned. Declaration public static IQueryable SelectMany(this IQueryable source, string collectionSelector, string resultSelector, string collectionParameterName, string resultParameterName, object[] collectionSelectorArgs = null, params object[] resultSelectorArgs) Parameters Type Name Description System.Linq.IQueryable source System.String collectionSelector System.String resultSelector System.String collectionParameterName System.String resultParameterName System.Object [] collectionSelectorArgs System.Object [] resultSelectorArgs Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable whose elements are the result of invoking the one-to-many projection function collectionSelector on each element of source and then mapping each of those sequence elements and their corresponding source element to a result element. | Improve this Doc View Source SelectMany(IQueryable, Type, String, Object[]) Projects each element of a sequence to an System.Linq.IQueryable and combines the resulting sequences into one sequence. Declaration public static IQueryable SelectMany(this IQueryable source, Type resultType, string selector, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.Type resultType System.String selector System.Object [] args Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable whose elements are the result of invoking a one-to-many projection function on each element of the input sequence. | Improve this Doc View Source SelectMany(IQueryable, ParsingConfig, String, Object[]) Projects each element of a sequence to an System.Linq.IQueryable and combines the resulting sequences into one sequence. Declaration public static IQueryable SelectMany(this IQueryable source, ParsingConfig config, string selector, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence of values to project. ParsingConfig config The ParsingConfig . System.String selector A projection string expression to apply to each element. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable whose elements are the result of invoking a one-to-many projection function on each element of the input sequence. Type Parameters Name Description TResult The type of the result. Examples var permissions = users.SelectMany(\"Roles.SelectMany(Permissions)\"); | Improve this Doc View Source SelectMany(IQueryable, String, Object[]) Projects each element of a sequence to an System.Linq.IQueryable and combines the resulting sequences into one sequence. Declaration public static IQueryable SelectMany(this IQueryable source, string selector, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String selector System.Object [] args Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable whose elements are the result of invoking a one-to-many projection function on each element of the input sequence. Type Parameters Name Description TResult The type of the result. | Improve this Doc View Source Single(IQueryable) Returns the only element of a sequence, and throws an exception if there is not exactly one element in the sequence. Declaration public static object Single(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source A System.Linq.IQueryable to return the single element of. Returns Type Description System.Object The single element of the input sequence. | Improve this Doc View Source Single(IQueryable, ParsingConfig, String, Object[]) Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there is not exactly one element in the sequence. Declaration public static object Single(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return the last element of. ParsingConfig config The ParsingConfig . System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Object The first element in source that passes the test in predicate. | Improve this Doc View Source Single(IQueryable, LambdaExpression) Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there is not exactly one element in the sequence. Declaration public static object Single(this IQueryable source, LambdaExpression lambda) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return the last element of. System.Linq.Expressions.LambdaExpression lambda A cached Lambda Expression. Returns Type Description System.Object The first element in source that passes the test in predicate. | Improve this Doc View Source Single(IQueryable, String, Object[]) Returns the only element of a sequence that satisfies a specified condition, and throws an exception if there is not exactly one element in the sequence. Declaration public static object Single(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Object The first element in source that passes the test in predicate. | Improve this Doc View Source SingleOrDefault(IQueryable) Returns the only element of a sequence, or a default value if the sequence is empty; this method throws an exception if there is more than one element in the sequence. Declaration public static object SingleOrDefault(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source A System.Linq.IQueryable to return the single element of. Returns Type Description System.Object The single element of the input sequence, or default if the sequence contains no elements. | Improve this Doc View Source SingleOrDefault(IQueryable, ParsingConfig, String, Object[]) Returns the only element of a sequence that satisfies a specified condition or a default value if the sequence is empty; and throws an exception if there is not exactly one element in the sequence. Declaration public static object SingleOrDefault(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return the last element of. ParsingConfig config The ParsingConfig . System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Object The first element in source that passes the test in predicate. | Improve this Doc View Source SingleOrDefault(IQueryable, LambdaExpression) Returns the only element of a sequence that satisfies a specified condition or a default value if the sequence is empty; and throws an exception if there is not exactly one element in the sequence. Declaration public static object SingleOrDefault(this IQueryable source, LambdaExpression lambda) Parameters Type Name Description System.Linq.IQueryable source The System.Linq.IQueryable to return the last element of. System.Linq.Expressions.LambdaExpression lambda A cached Lambda Expression. Returns Type Description System.Object The first element in source that passes the test in predicate. | Improve this Doc View Source SingleOrDefault(IQueryable, String, Object[]) Returns the only element of a sequence that satisfies a specified condition or a default value if the sequence is empty; and throws an exception if there is not exactly one element in the sequence. Declaration public static object SingleOrDefault(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Object The first element in source that passes the test in predicate. | Improve this Doc View Source Skip(IQueryable, Int32) Bypasses a specified number of elements in a sequence and then returns the remaining elements. Declaration public static IQueryable Skip(this IQueryable source, int count) Parameters Type Name Description System.Linq.IQueryable source A System.Linq.IQueryable to return elements from. System.Int32 count The number of elements to skip before returning the remaining elements. Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable that contains elements that occur after the specified index in the input sequence. | Improve this Doc View Source SkipWhile(IQueryable, ParsingConfig, String, Object[]) Bypasses elements in a sequence as long as a specified condition is true and then returns the remaining elements. Declaration public static IQueryable SkipWhile(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence to check for being empty. ParsingConfig config The ParsingConfig . System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable that contains elements from source starting at the first element in the linear series that does not pass the test specified by predicate. Examples IQueryable queryable = employees.AsQueryable(); var result1 = queryable.SkipWhile(\"Income > 50\"); var result2 = queryable.SkipWhile(\"Income > @0\", 50); | Improve this Doc View Source SkipWhile(IQueryable, String, Object[]) Bypasses elements in a sequence as long as a specified condition is true and then returns the remaining elements. Declaration public static IQueryable SkipWhile(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable that contains elements from source starting at the first element in the linear series that does not pass the test specified by predicate. | Improve this Doc View Source Sum(IQueryable) Computes the sum of a sequence of numeric values. Declaration [PublicAPI] public static object Sum(this IQueryable source) Parameters Type Name Description System.Linq.IQueryable source A sequence of numeric values to calculate the sum of. Returns Type Description System.Object The sum of the values in the sequence. Examples IQueryable queryable = employees.AsQueryable(); var result1 = queryable.Sum(); var result2 = queryable.Select(\"Roles.Sum()\"); | Improve this Doc View Source Sum(IQueryable, ParsingConfig, String, Object[]) Computes the sum of a sequence of numeric values. Declaration [PublicAPI] public static object Sum(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence of numeric values to calculate the sum of. ParsingConfig config The ParsingConfig . System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Object The sum of the values in the sequence. Examples IQueryable queryable = employees.AsQueryable(); var result = queryable.Sum(\"Income\"); | Improve this Doc View Source Sum(IQueryable, LambdaExpression) Computes the sum of a sequence of numeric values. Declaration [PublicAPI] public static object Sum(this IQueryable source, LambdaExpression lambda) Parameters Type Name Description System.Linq.IQueryable source A sequence of numeric values to calculate the sum of. System.Linq.Expressions.LambdaExpression lambda A Lambda Expression. Returns Type Description System.Object The sum of the values in the sequence. | Improve this Doc View Source Sum(IQueryable, String, Object[]) Computes the sum of a sequence of numeric values. Declaration [PublicAPI] public static object Sum(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Object The sum of the values in the sequence. | Improve this Doc View Source Take(IQueryable, Int32) Returns a specified number of contiguous elements from the start of a sequence. Declaration public static IQueryable Take(this IQueryable source, int count) Parameters Type Name Description System.Linq.IQueryable source The sequence to return elements from. System.Int32 count The number of elements to return. Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable that contains the specified number of elements from the start of source. | Improve this Doc View Source TakeWhile(IQueryable, ParsingConfig, String, Object[]) Returns elements from a sequence as long as a specified condition is true. Declaration public static IQueryable TakeWhile(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A sequence to check for being empty. ParsingConfig config The ParsingConfig . System.String predicate A function to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable that contains elements from the input sequence occurring before the element at which the test specified by predicate no longer passes. Examples IQueryable queryable = employees.AsQueryable(); var result1 = queryable.TakeWhile(\"Income > 50\"); var result2 = queryable.TakeWhile(\"Income > @0\", 50); | Improve this Doc View Source TakeWhile(IQueryable, String, Object[]) Returns elements from a sequence as long as a specified condition is true. Declaration public static IQueryable TakeWhile(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Linq.IQueryable An System.Linq.IQueryable that contains elements from the input sequence occurring before the element at which the test specified by predicate no longer passes. | Improve this Doc View Source ThenBy(IOrderedQueryable, ParsingConfig, String, IComparer, Object[]) Performs a subsequent ordering of the elements in a sequence in ascending order according to a key. Declaration public static IOrderedQueryable ThenBy(this IOrderedQueryable source, ParsingConfig config, string ordering, IComparer comparer, params object[] args) Parameters Type Name Description System.Linq.IOrderedQueryable source A sequence of values to order. ParsingConfig config The ParsingConfig . System.String ordering An expression string to indicate values to order by. System.Collections.IComparer comparer The comparer to use. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IOrderedQueryable A System.Linq.IQueryable whose elements are sorted according to the specified ordering . | Improve this Doc View Source ThenBy(IOrderedQueryable, ParsingConfig, String, Object[]) Performs a subsequent ordering of the elements in a sequence in ascending order according to a key. Declaration public static IOrderedQueryable ThenBy(this IOrderedQueryable source, ParsingConfig config, string ordering, params object[] args) Parameters Type Name Description System.Linq.IOrderedQueryable source A sequence of values to order. ParsingConfig config The ParsingConfig . System.String ordering An expression string to indicate values to order by. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IOrderedQueryable A System.Linq.IQueryable whose elements are sorted according to the specified ordering . Examples var result = queryable.OrderBy(\"LastName\"); var resultSingle = result.OrderBy(\"NumberProperty\"); var resultSingleDescending = result.OrderBy(\"NumberProperty DESC\"); var resultMultiple = result.OrderBy(\"NumberProperty, StringProperty DESC\"); | Improve this Doc View Source ThenBy(IOrderedQueryable, String, IComparer, Object[]) Performs a subsequent ordering of the elements in a sequence in ascending order according to a key. Declaration public static IOrderedQueryable ThenBy(this IOrderedQueryable source, string ordering, IComparer comparer, params object[] args) Parameters Type Name Description System.Linq.IOrderedQueryable source System.String ordering System.Collections.IComparer comparer System.Object [] args Returns Type Description System.Linq.IOrderedQueryable A System.Linq.IQueryable whose elements are sorted according to the specified ordering . | Improve this Doc View Source ThenBy(IOrderedQueryable, String, Object[]) Performs a subsequent ordering of the elements in a sequence in ascending order according to a key. Declaration public static IOrderedQueryable ThenBy(this IOrderedQueryable source, string ordering, params object[] args) Parameters Type Name Description System.Linq.IOrderedQueryable source System.String ordering System.Object [] args Returns Type Description System.Linq.IOrderedQueryable A System.Linq.IQueryable whose elements are sorted according to the specified ordering . | Improve this Doc View Source ThenBy(IOrderedQueryable, ParsingConfig, String, IComparer, Object[]) Performs a subsequent ordering of the elements in a sequence in ascending order according to a key. Declaration public static IOrderedQueryable ThenBy(this IOrderedQueryable source, ParsingConfig config, string ordering, IComparer comparer, params object[] args) Parameters Type Name Description System.Linq.IOrderedQueryable source A sequence of values to order. ParsingConfig config The ParsingConfig . System.String ordering An expression string to indicate values to order by. System.Collections.IComparer comparer The comparer to use. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IOrderedQueryable A System.Linq.IOrderedQueryable whose elements are sorted according to the specified ordering . Type Parameters Name Description TSource The type of the elements of source. | Improve this Doc View Source ThenBy(IOrderedQueryable, ParsingConfig, String, Object[]) Performs a subsequent ordering of the elements in a sequence in ascending order according to a key. Declaration public static IOrderedQueryable ThenBy(this IOrderedQueryable source, ParsingConfig config, string ordering, params object[] args) Parameters Type Name Description System.Linq.IOrderedQueryable source A sequence of values to order. ParsingConfig config The ParsingConfig . System.String ordering An expression string to indicate values to order by. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IOrderedQueryable A System.Linq.IOrderedQueryable whose elements are sorted according to the specified ordering . Type Parameters Name Description TSource The type of the elements of source. Examples var result = queryable.OrderBy(\"LastName\"); var resultSingle = result.ThenBy(\"NumberProperty\"); var resultSingleDescending = result.ThenBy(\"NumberProperty DESC\"); var resultMultiple = result.ThenBy(\"NumberProperty, StringProperty\"); | Improve this Doc View Source ThenBy(IOrderedQueryable, String, IComparer, Object[]) Performs a subsequent ordering of the elements in a sequence in ascending order according to a key. Declaration public static IOrderedQueryable ThenBy(this IOrderedQueryable source, string ordering, IComparer comparer, params object[] args) Parameters Type Name Description System.Linq.IOrderedQueryable source A sequence of values to order. System.String ordering An expression string to indicate values to order by. System.Collections.IComparer comparer The comparer to use. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IOrderedQueryable A System.Linq.IOrderedQueryable whose elements are sorted according to the specified ordering . Type Parameters Name Description TSource The type of the elements of source. | Improve this Doc View Source ThenBy(IOrderedQueryable, String, Object[]) Performs a subsequent ordering of the elements in a sequence in ascending order according to a key. Declaration public static IOrderedQueryable ThenBy(this IOrderedQueryable source, string ordering, params object[] args) Parameters Type Name Description System.Linq.IOrderedQueryable source System.String ordering System.Object [] args Returns Type Description System.Linq.IOrderedQueryable A System.Linq.IOrderedQueryable whose elements are sorted according to the specified ordering . Type Parameters Name Description TSource The type of the elements of source. | Improve this Doc View Source Where(IQueryable, ParsingConfig, String, Object[]) Filters a sequence of values based on a predicate. Declaration public static IQueryable Where(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A System.Linq.IQueryable to filter. ParsingConfig config The ParsingConfig . System.String predicate An expression string to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable that contains elements from the input sequence that satisfy the condition specified by predicate. Examples var result1 = queryable.Where(\"NumberProperty = 1\"); var result2 = queryable.Where(\"NumberProperty = @0\", 1); var result3 = queryable.Where(\"StringProperty = null\"); var result4 = queryable.Where(\"StringProperty = \\\"abc\\\"\"); var result5 = queryable.Where(\"StringProperty = @0\", \"abc\"); | Improve this Doc View Source Where(IQueryable, LambdaExpression) Filters a sequence of values based on a predicate. Declaration public static IQueryable Where(this IQueryable source, LambdaExpression lambda) Parameters Type Name Description System.Linq.IQueryable source A System.Linq.IQueryable to filter. System.Linq.Expressions.LambdaExpression lambda A cached Lambda Expression. Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable that contains elements from the input sequence that satisfy the condition specified by LambdaExpression. | Improve this Doc View Source Where(IQueryable, String, Object[]) Filters a sequence of values based on a predicate. Declaration public static IQueryable Where(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable that contains elements from the input sequence that satisfy the condition specified by predicate. | Improve this Doc View Source Where(IQueryable, ParsingConfig, String, Object[]) Filters a sequence of values based on a predicate. Declaration public static IQueryable Where(this IQueryable source, ParsingConfig config, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source A System.Linq.IQueryable to filter. ParsingConfig config The ParsingConfig . System.String predicate An expression string to test each element for a condition. System.Object [] args An object array that contains zero or more objects to insert into the predicate as parameters. Similar to the way String.Format formats strings. Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable that contains elements from the input sequence that satisfy the condition specified by predicate. Type Parameters Name Description TSource The type of the elements of source. Examples var result1 = queryable.Where(\"NumberProperty = 1\"); var result2 = queryable.Where(\"NumberProperty = @0\", 1); var result3 = queryable.Where(\"StringProperty = null\"); var result4 = queryable.Where(\"StringProperty = \\\"abc\\\"\"); var result5 = queryable.Where(\"StringProperty = @0\", \"abc\"); | Improve this Doc View Source Where(IQueryable, LambdaExpression) Filters a sequence of values based on a predicate. Declaration public static IQueryable Where(this IQueryable source, LambdaExpression lambda) Parameters Type Name Description System.Linq.IQueryable source System.Linq.Expressions.LambdaExpression lambda A cached Lambda Expression. Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable that contains elements from the input sequence that satisfy the condition specified by LambdaExpression. Type Parameters Name Description TSource | Improve this Doc View Source Where(IQueryable, String, Object[]) Filters a sequence of values based on a predicate. Declaration public static IQueryable Where(this IQueryable source, string predicate, params object[] args) Parameters Type Name Description System.Linq.IQueryable source System.String predicate System.Object [] args Returns Type Description System.Linq.IQueryable A System.Linq.IQueryable